Conserved Protein Domain Family
PRK06743

?
PRK06743: PRK06743 
flagellar motor protein MotP; Reviewed
Statistics
?
PSSM-Id: 136027
View PSSM: PRK06743
Aligned: 18 rows
Threshold Bit Score: 429.395
Threshold Setting Gi: 30019772
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30261728    1 MGIIVGFAIVIAAIMLGGGGIKAFKNFLDVSSILIVIGGTTATIVVAYRFGEIKKYTKSIFTVLHRREEDLEQLTDLFVD 80 
49184554    1 MGIIVGFAIVIAAIMLGGGGIKAFKNFLDVSSILIVIGGTTATIVVAYRFGEIKKYTKSIFTVLHRREEDLEQLTDLFVD 80 
47526944    1 MGIIVGFAIVIAAIMLGGGGIKAFKNFLDVSSILIVIGGTTATIVVAYRFGEIKKYTKSIFTVLHRREEDLEQLTDLFVD 80 
42780819   24 FGILVGFAIVIAAIMLGGGGIKAFKNFLDVSSILIVIGGTTATIVVAYRFGEIKKYTKSIFTVLHRKEEDLEQLTDLFVD 103
52143731   24 VGIIVGFSIVIAAIMLGGGGIKAFKNFLDVSSILIVIGGTTATIVVAYRFGEIKKYTKSIFTVLHRREEDLEQLTDLFVD 103
222095351  24 FGILVGFAIVIAAIMLGGGGIKAFKNFLDVSSILIVIGGTTATIVVAYRFGEIKKYTKSIFTVLHRKEEDLEQLTDLFVD 103
217959211  24 FGILVGFAIVIAAIMLGGGGIKAFKNFLDVSSILIVIGGTTATIVVAYRFGEIKKYTKSIFTVLHRKEEDLEQLTDLFVD 103
218902842  24 VGIIVGFAIVIAAIMLGGGGIKAFKNFLDVSSILIVIGGTTATIVVAYRFGEIKKYTKSIFTVLHRREEDLEQLTDLFVD 103
118477163  31 VGIIVGFAIVIAAIMLGGGGIKAFKNFLDVSSILIVIGGTTATIVVAYRFGEIKKYTKSIFTVLHRKEEDLEQLTDLFVD 110
49477309   24 VGIIVGFAIVIAAIMLGGGGIKAFKNFLDVSSILIVIGGTTATIVVAYRFGEIKKYTKSIFTVLHRREEDLEQLTDLFVD 103
30261728   81 FSKKSKKHGLLSLEVDGEQVDNPFIQKGIRLMLSGYDEEELKEVLMKDVETEVYELRKGAALLDKIGDFAPAWGMIGTLI 160
49184554   81 FSKKSKKHGLLSLEVDGEQVDNPFIQKGIRLMLSGYDEEELKEVLMKDVETEVYELRKGAALLDKIGDFAPAWGMIGTLI 160
47526944   81 FSKKSKKHGLLSLEVDGEQVDNPFIQKGIRLMLSGYDEEELKEVLMKDVETEVYELRKGAALLDKIGDFAPAWGMIGTLI 160
42780819  104 FSKKSKKHGLLSLEVDGEQVDNPFIQKGIRLMLSGYDEDELKEVLMKDVETEVYELRKGAVLLDKIGDFAPAWGMIGTLI 183
52143731  104 FSKKSKKHGLLSLEVDGEQVDNPFIQKGIRLMLSGYDEEELKEVLMKDVETEVYELRKGAALLDKIGDFAPAWGMIGTLI 183
222095351 104 FSKKSKKHGLLSLEVDGEQVDNPFIQKGIRLMLSGYDEDELKEVLMKDVETEVYELRKGAVLLDKIGDFAPAWGMIGTLI 183
217959211 104 FSKKSKKHGLLSLEVDGEQVDNPFIQKGIRLMLSGYDEDELKEVLMKDVETEVYELRKGAVLLDKIGDFAPAWGMIGTLI 183
218902842 104 FSKKSKKHGLLSLEVDGEQVDNPFIQKGIRLMLSGYDEDELKEVLMKDVETEVYELRKGAVLLDKIGDFAPAWGMIGTLI 183
118477163 111 FSKKSKKHGLLSLEVDGEQVDNPFIQKGIRLMLSGYDEEELKEVLMKDVETEVYELRKGAALLDKIGDFAPAWGMIGTLI 190
49477309  104 FSKKSKKHGLLSLEVDGEQVDNPFIQKGIRLMLSGYDEDELKEVLMKDVETEVYELRKGAVLLDKIGDFAPAWGMIGTLI 183
30261728  161 GLIIMLQNLQDTSQIGTGMAVAMLTTLYGSVLANMIAIPLAEKVYRGIEDLYTEKKFVIEAISELYRGQIPSKLKLKLDT 240
49184554  161 GLIIMLQNLQDTSQIGTGMAVAMLTTLYGSVLANMIAIPLAEKVYRGIEDLYTEKKFVIEAISELYRGQIPSKLKLKLDT 240
47526944  161 GLIIMLQNLQDTSQIGTGMAVAMLTTLYGSVLANMIAIPLAEKVYRGIEDLYTEKKFVIEAISELYRGQIPSKLKLKLDT 240
42780819  184 GLIIMLQNLQDTSQIGTGMAVAMLTTLYGSVLANMIAIPLAEKVYRGIEDLYTEKKFVIEAISELYRGQIPSKLKLKLDT 263
52143731  184 GLIIMLQNLQDTSQIGTGMAVAMLTTLYGSVLANMIAIPLAEKVYRGIEDLYTEKKFVIEAISELYRGQIPSKLKLKLDT 263
222095351 184 GLIIMLQNLQDTSQIGTGMAVAMLTTLYGSVLANMIAIPLAEKVYRGIEDLYTEKKFVIEAISELYRGQIPSKLKLKLDT 263
217959211 184 GLIIMLQNLQDTSQIGTGMAVAMLTTLYGSVLANMIAIPLAEKVYRGIEDLYTEKKFVIEAISELYRGQIPSKLKLKLDT 263
218902842 184 GLIIMLQNLQDTSQIGTGMAVAMLTTLYGSVLANMIAIPLSEKVYRGIEDLYTEKKFVIEAISELYRGQIPSKLKLKLDT 263
118477163 191 GLIIMLQNLQDTSQIGTGMAVAMLTTLYGSVLANMIAIPLAEKVYRGIEDLYTEKKFVIEAISELYRGQIPSKLKLKLDT 270
49477309  184 GLIIMLQNLQDTSQIGTGMAVAMLTTLYGSVLANMIAIPLSEKVYRGIEDLYTEKKFVIEAISELYRGQIPSKLKLKLDT 263
30261728  241 YVYETKIKKVKRAA 254
49184554  241 YVYETKIKKVKRAA 254
47526944  241 YVYETKIKKVKRAA 254
42780819  264 YVYETKIKKVKRAA 277
52143731  264 YVYETKIKKVKRAA 277
222095351 264 YVYETKIKKVKRAA 277
217959211 264 YVYETKIKKVKRAA 277
218902842 264 YVYETKIKKVKRAA 277
118477163 271 YVYETKIKKVKRAA 284
49477309  264 YVYETKIKKVKRAA 277
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap