Conserved Protein Domain Family
PRK06742

?
PRK06742: PRK06742 
flagellar motor protein MotS; Reviewed
Statistics
?
PSSM-Id: 102525
View PSSM: PRK06742
Aligned: 20 rows
Threshold Bit Score: 421.008
Threshold Setting Gi: 152975140
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30261729    1 MIKRPQKGSPRWMTTFTDLTMLLLTFFVLLVATSKQDAVKLSKMLEKFSDTEQVDAKVMENTIPDISHEKNDEKMISKKR 80 
42780820    1 MIKRPQKGSPRWMTTFTDLTMLLLTFFVLLVATSKQDAVKLSKMLEKFSDTEQVDAKVMENTIPDISHEKNDEKMVSKKR 80 
30019773    2 MSKGPQKGSPRWMTTFTDLTMLLLTFFVLLVATSKQDAVKLSKMLEKFSDTEQVDAKVMENTIPDISHEKNDEKMISKKR 81 
222095352   1 MIKRPQKGSPRWMTTFTDLTMLLLTFFVLLVATSKQDAVKLSKMLEKFSDTEQVDAKVMENTIPDISHEKNDEKTVSKKR 80 
218896660   1 MSKGPQKGSPRWMTTFTDLTMLLLTFFVLLVATSKQDAVKLSKMLEKFSDTGQVDAKVMENTIPDISHEKNDEKMISKKR 80 
218233445   1 MSKGPQKGSPRWMTTFTDLTMLLLTFFVLLVATSKQDAVKLSKMLEKFSDTGQVDAKVMENTIPDISHEKNDEKMISKKR 80 
217959212   1 MIKRPQKGSPRWMTTFTDLTMLLLTFFVLLVATSKQDAVKLSKMLEKFSDTEQVDAKVMENTIPDISHEKNDEKTVSKKR 80 
118477164   3 MMKRPQKGSPRWMTTFTDLTMLLLTFFVLLVATSKQDAVKLSKMLEKFSDTEQVDAKVMENTIPDISHEKNDEKMISKKR 82 
296502310   1 MSKGPQKGSPRWMTTFTDLTMLLLTFFVLLVATSKQDAVKLSKMLEKFSDTGQVDAKVMENTIPDISHEKNDEKMISKKR 80 
49480957    1 MMKRPQKGSPRWMTTFTDLTMLLLTFFVLLVATSKQDAVKLSKMLEKFSDTEQVDAKVMENTIPDISHEKNDEKMISKKR 80 
30261729   81 MDELYKKLKAYVDNNGISQVNVYREDTGVSVVIVDNLIFDTGDANVKPEAKEIISQLVGFFQSVPNPIVVEGHTDSRPIH 160
42780820   81 MDDLYKKLKAYVDNNGISQVNVYREDTGVSVVIVDNLIFDTGDANVKPEAKEIISKLVGFFQSVPNSIVVEGHTDSRPIH 160
30019773   82 MDELYKKLKAYVDNNGISQVNVYREDTGVSVVIVDNLIFDTGDANVKPEAKGIISQLVGFFQSVPNPIVVEGHTDSRPIH 161
222095352  81 MDDLYKKLKAYVDNNGISQVNVYREDTGVSVVIVDNLIFDTGDANVKPEAKEIISKLVGFFQSVPNSIVVEGHTDSRPIH 160
218896660  81 MDELYKKLKAYVDNNGISQVNVYREDTGVSVVIVDNLIFDTGDANVKPEAKGIISQLVGFFQSVPNPIVVEGHTDSRPIH 160
218233445  81 MDELYKKLKAYVDNNGISQVNVYREDTGVSVVIVDNLIFDTGDANVKPEAKGIISQLVGFFQSVPNPIVVEGHTDSRPIH 160
217959212  81 MDDLYKKLKAYVDNNGISQVNVYREDTGVSVVIVDNLIFDTGDANVKPEAKEIISKLVGFFQSVPNSIVVEGHTDSRPIH 160
118477164  83 MDELYKKLKAYVDNNGISQVNVYREDTGVSVVIVDNLIFDTGDANVKPEAKEIISQLVGFFQSVPNPIVVEGHTDSRPIH 162
296502310  81 MDELYKKLKAYVDNNGISQVNVYREDTGVSVVIVDNLIFDTGDANVKPEAKGIISQLVGFFQSVPNPIVVEGHTDSRPIH 160
49480957   81 MDELYKKLKAYVDNNGISQVNVYREDTGVSVVIVDNLIFDTGDANVKPEAKEIISQLVGFFQSVPNPIVVEGHTDSRPIH 160
30261729  161 NDKFPSNWELSSARAANMIHHLIEVYNVDDKRLAAVGYADTKPVVPNDSPQNWEKNRRVVIYIKE 225
42780820  161 NEKFPSNWELSSARAANMIHHLIEVYNVEDKRLAAVGYADTKPVVPNDSPQNWEKNRRVVIYIKE 225
30019773  162 NEKFPSNWELSSARAANMIHHLIEVYNVDDKRLAAVGYADTKPIVPNDSPQNWEKNRRVVIYIKE 226
222095352 161 NEKFPSNWELSSARAANMIHHLIEVYNVEDKRLAAVGYADTKPVVPNDSPQNWEKNRRVVIYIKE 225
218896660 161 NEKFPSNWELSSARAANMIHHLIEVYNVDDKRLAAVGYADTKPIVPNDSPQNWEKNRRVVIYIKE 225
218233445 161 NEKFPSNWELSSARAANMIHHLIEVYNVDDKRLAAVGYADTKPIVPNDSPQNWEKNRRVVIYIKE 225
217959212 161 NEKFPSNWELSSARAANMIHHLIEVYNVDDKRLAAVGYADTKPVVPNDSPQNWEKNRRVVIYIKE 225
118477164 163 NDKFPSNWELSSARAANMIHHLIEVYNVDDKRLAAVGYADTKPVVPNDSPQNWEKNRRVVIYIKE 227
296502310 161 NEKFPSNWELSSARAANMIHHLIEVYNVDDKRLAAVGYADTKPIVPNDSPQNWEKNRRVVIYIKE 225
49480957  161 NDKFPSNWELSSARAANMIHHLIEVYNVDDKRLAAVGYADTKPVVPNDSPQNWEKNRRVVIYIKE 225
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap