Conserved Protein Domain Family
flhF

?
PRK06731: flhF 
flagellar biosynthesis regulator FlhF; Validated
Statistics
?
PSSM-Id: 75717
View PSSM: PRK06731
Aligned: 2 rows
Threshold Bit Score: 483.48
Threshold Setting Gi: 49184610
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
49184610  12 VVVKKEKQESVPFIIQKVIRMLEQNDVEQYFIHAYAEKLKVKFENATMITEEVIEYILEDMSSHFNTENVFEKEVQTIAL 91 
30261776   1 MVVKKEKQESVPFIIQKVIRMLEQNDVEQYFIHAYAEKLKVKFENATMITEEVIEYILEDMSSHFNTENVFEKEVQTIAL 80 
49184610  92 IGPTGVGKTTTLAKMAWQFHGKKKTVGFITTDHSRIGTVQQLQDYVKTIGFEVIAVRDEAAMTRALTYFKEEARVDYILI 171
30261776  81 IGPTGVGKTTTLAKMAWQFHGKKKTVGFITTDHSRIGTVQQLQDYVKTIGFEVIAVRDEAAMTRALTYFKEEARVDYILI 160
49184610 172 DTAGKNYRASETVEEMIETMGQVEPDYICLTLSASMKSKDMIEIITNFKDIHIDGIVFTKFDETASSGELLKIPAVSSAP 251
30261776 161 DTAGKNYRASETVEEMIETMGQVEPDYICLTLSASMKSKDMIEIITNFKDIHIDGIVFTKFDETASSGELLKIPAVSSAP 240
49184610 252 IVLMTDGQDVKKNIHIATAEHLAKQMLQTS 281
30261776 241 IVLMTDGQDVKKNIHIATAEHLAKQMLQTS 270
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap