Conserved Protein Domain Family
PRK06728

?
PRK06728: PRK06728 
aspartate-semialdehyde dehydrogenase; Provisional
Statistics
?
PSSM-Id: 136022
View PSSM: PRK06728
Aligned: 19 rows
Threshold Bit Score: 680.622
Threshold Setting Gi: 42781527
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30262435    1 MSEKGYHLAVVGATGAVGQKIIELLEKETKFNIAEVTLLSSKRSAGKTVQFKGREIIIQEAKINSFEGIDIAFFSAGGEV 80 
42781527    1 MSEKGYHVAIVGATGAVGQKIIELLEKETKFNIAEVTLLSSKRSAGKTVQFKGREIIIQEAKINSFEGVDIAFFSAGGEV 80 
30020494    1 MIKKGYHVAVVGATGAVGQKIIELLENEMKFNVVEVTLLSSKRSAGKKVRFKGREIIIQEAKTTSFEGVDIAFFSAGGEV 80 
222096015   1 MSEKGYHVAVVGATGAVGQKIIELLEKETKFNITEVTLLSSKRSAGKTVQFKGREIIIQEAKINSFEGVDIAFFSAGGEV 80 
218897370   1 MIKKGYHVAVVGATGAVGQKIIELLENEMKFNIVEVTLLSSKRSAGKKVRFKGREIIIQEAKTTSFEGVDIAFFSAGGEV 80 
217959926   1 MSEKGYHVAVVGATGAVGQKIIELLEKETKFNITEVTLLSSKRSAGKTVQFKGREIIIQEAKINSFEGVDIAFFSAGGEV 80 
225864392   1 MSEKGYHVAVVGATGAVGQKIIELLEKETKFNITEVTLLSSKRSAGKTVQFKGRETIIQEAKINSFEGVDIAFFSAGGEV 80 
118477826   1 MSEKGYHVAVVGATGAVGQKIIELLEKETKFNITEVTLLSSKRSAGKTVQFKGRETIIQEAKINSFEGVDIAFFSAGGEV 80 
296502958   1 MIKKGYHVAVVGATGAVGQKIIELLENEMKFNIVEVTLLSSKRSAGKKVRFKGREIIIQEAKTTSFEGVDIAFFSAGGEV 80 
163940205   1 MSEKSYHVAVVGATGAVGQKIIALLERVTKFNIEEITLLSSKRSAGKIVQFKGREIKIQEAKSTSFEGVDIAFFSAGGEV 80 
30262435   81 SRQFVNQAVSSGAIVIDNTSEYRMAHDVPLVVPEVNTHTLKEHKGIIAVPNCSALQMVTALQPIRKVFGLERIIVSTYQA 160
42781527   81 SRQFVNQAVSSGAIVIDNTSEYRMAPDVPLVVPEVNAHTLKEHKGIIAVPNCSALQMVTALQPIRKVFGLERIIVSTYQA 160
30020494   81 SRQFVTHAVSSGAIVIDNTSEYRMAQGVPLVVPEVNAHTLKQHKGIIAVPNCSALQMVTALQPIRKSFGLERIIVSTYQA 160
222096015  81 SRQFVNQAVSSGAIVIDNTSKYRMAHDVPLVVPEVNAHTLKEHKGIIAVPNCSALQMVTALQPIRKVFGLERIIVSTYQA 160
218897370  81 SRQFVTHAVSSGAIVIDNTSEYRMAQGVPLVVPEVNAHTLERHKGIIAVPNCSALQMVTALQPIRKSFGLERIIVSTYQA 160
217959926  81 SRQFVNQAVSSGAIVIDNTSKYRMAHDVPLVVPEVNAHTLKEHKGIIAVPNCSALQMVTALQPIRKVFGLERIIVSTYQA 160
225864392  81 SRQFVNQVVSSGAIVIDNTSEYRMAHDVPLVVPEVNAHTLKEHKGIIAVPNCSALQMVTALQPIRKVFGLERIIVSTYQA 160
118477826  81 SRQFVNQVVSSGAIVIDNTSEYRMAHDVPLVVPEVNAHTLKEHKGIIAVPNCSALQMVTALQPIRKVFGLERIIVSTYQA 160
296502958  81 SRQFVTHAVSSGAIVIDNTSEYRMAQGVPLVVPEVNAHTLKQHKGIIAVPNCSALQMVTALQPIRKSFGLERIIVSTYQA 160
163940205  81 SRQYVNHAVSSGAIVIDNTSEYRMAHDVPLVVPEVNAHTLREHKRIIAVPNCSALQMVTALQPIRKSFGLERIIVSTYQA 160
30262435  161 VSGSGIHAIQELKEQAKSILAGEEVESTILPAKKDKKHYPIAFNVLPQVDIFTDNDFTFEEVKMIQETKKILEDPNLKMA 240
42781527  161 VSGSGIHAIQELKEQAKSILAGEEVESTILPAKKDKKHYPIAFNVLPQVDIFTDNDFTFEEVKMIQETKKILEDPNLKMA 240
30020494  161 VSGSGIHAIHELREQAKSILAGEEVKSDILPVKKDKKHYPIAFNVLPQVDIFTDNDFTFEEVKMIQETKKILEDENLKMA 240
222096015 161 VSGSGIHAIQELKEQAKSILAGEEVESTILPAKKDKKHYPIAFNVLPQVDIFTDNDFTFEEVKMIQETKKILEDPNLKMA 240
218897370 161 VSGSGIHAIHELQEQAKSMLAGKEVKSDILPAKKDKKHYPIAFNVLPQVDIFTDNDFTFEEVKMIQETKKILEDENLKMA 240
217959926 161 VSGSGIHAIQELKEQAKSILAGEEVESTILPAKKDKKHYPIAFNVLPQVDIFTDNDFTFEEVKMIQETKKILEDPNLKMA 240
225864392 161 VSGSGIHAIQELKEQAKSILAGEEVESTILPAKKDKKHYPIAFNVLPQVDIFTDNDFTFEEVKMIQETKKILEDPNLKMA 240
118477826 161 VSGSGIHAIQELKEQAKSILAGEEVESTILPAKKDKKHYPIAFNVLPQVDIFTDNDFTFEEVKMIQETKKILEDPNLKMA 240
296502958 161 VSGSGIHAIHELREQAKSILAGEEVKSDILPVKKDKKHYPIAFNVLPQVDIFTDNDFTFEEVKMIQETKKILEDENLKMA 240
163940205 161 VSGSGIHAIHELKEQAKSMLTGEEVKSTILPVKKDKKHYPIAFNVLPQVDIFTDNDFTFEEVKMIQETKKILEDPNLKMA 240
30262435  241 ATCVRVPVISGHSESVYIELEKEATVAEIKEVLFDAPGVILQDNPSEQLYPMPLYAEGKIDTFVGRIRKDPDTPNGFHLW 320
42781527  241 ATCVRVPVVSGHSEAXYIELEKEVTVAEIXEVLLDAPGVILQDNPSEQLYPMPLYAEGKIDTFVGRIRKDPDMPNGFHLW 320
30020494  241 ATCVRVPVVSGHSESVYIELEKEASVAEIKGILMDAPGVILQDNPSEQLYPMPLYAEGKIDTFVGRIRKDPDTPNGFHLW 320
222096015 241 ATCVRVPVISGHSESVYIELEKEATVAEIKEVLFDAPGVILQDNPSEQLYPMPLYAEGKIDTFVGRIRKDPDTPNGFHLW 320
218897370 241 ATCVRVPVVSGHSESVYIELEKEATVAEIKEVLMDAPGVILQDNPSEQLYPMPLYAEGKIDTFVGRIRKDPDTPNGFHLW 320
217959926 241 ATCVRVPVISGHSESVYIELEKEATVAEIKEVLFDAPGVILQDNPSEQLYPMPLYAEGKIDTFVGRIRKDPDTPNGFHLW 320
225864392 241 ATCVRVPVISGHSESVYIELEKEATVAEIKEVLFDAPGVILQDNPSEQLYPIPLYAEGKIDTFVGRIRKDPDTPNGFHLW 320
118477826 241 ATCVRVPVISGHSESVYIELEKEATVAEIKEVLFDAPGVILQDNPSEQLYPMPLYAEGKIDTFVGRIRKDPDTPNGFHLW 320
296502958 241 ATCVRVPVVSGHSESVYIELEKEATVAEIKEVLMGAPGVILQDNPSEQLYPMPLYAEGKIDTFVGRIRKDPDTPNGFHLW 320
163940205 241 ATCVRVPVVSGHSESVYIELEKEATVAEIKEVLLNAPGVILQDNPSEQIYPTPLYAEGKRDTFVGRIRKDPDTPKGFHLW 320
30262435  321 IVSDNLLKGAAWNSVQIAETMAEEGII 347
42781527  321 IVSDNLLKGAAWNSVQIAETMVEEGII 347
30020494  321 IVSDNLLKGAAWNSVQIAETLVEKGIL 347
222096015 321 IVSDNLLKGAAWNSVQIAETMVEEGII 347
218897370 321 IVSDNLLKGAAWNSVQIAETLVEKGIL 347
217959926 321 IVSDNLLKGAAWNSVQIAETMVEEGII 347
225864392 321 IVSDNLLKGAAWNSVQIAETMVEEGII 347
118477826 321 IVSDNLLKGAAWNSVQIAETMVEEGII 347
296502958 321 IVSDNLLKGAAWNSVQIAETLVEKGIL 347
163940205 321 IVSDNLLKGAAWNSVQIAETLVEKGII 347
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap