Conserved Protein Domain Family
PRK06721

?
PRK06721: PRK06721 
threonine synthase; Reviewed
Statistics
?
PSSM-Id: 136018
View PSSM: PRK06721
Aligned: 20 rows
Threshold Bit Score: 633.264
Threshold Setting Gi: 218896954
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30261998    1 MYKGLLNQYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKDRGMVMAVAKAKEEGSEAIIC 80 
42781120    1 MYKGLLKQYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKDRGMVMAVAKAKEEGSEAIIC 80 
30020104    1 MYKGLLKQYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKDRGMVMAVAKAKEEGSEAIIC 80 
222095618   1 MYKGLLNEYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKDRGMVMAVAKAKEDGSEAIIC 80 
218896954   1 MYKGLLKQYASYLPVNEKTPDVSLMEGNTPLIPLLNISKQLGVQLYGKYEGANPTGSFKDRGMVMAVAKAKEEGSEAIIC 80 
218234635   1 MYKGLLKQYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKDRGMVMAVAKAKEEGSEAIIC 80 
217959475   1 MYKGLLNEYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKDRGMVMAVAKAKEEGSEAIIC 80 
225863927   1 MYKGLLKQYASYLPVNENTPDVSLMEGNTPLIPLLNISNQLGIQLYGKYEGANPTGSFKDRGMVMAVAKAKEEGSEAIIC 80 
118477422   7 MYKGLLKQYASYLPVNENTPDVSLMEGNTPLIPLLNISNQLGIQLYGKYEGANPTGSFKDRGMVMAVAKAKEEGSEAIIC 86 
163939811   1 MYKGLLKQYVSYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKDRGMVMAVAKAKEEGAEAIIC 80 
30261998   81 ASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVAYGAEIISIEGNFDDALKAVRNIAEEEPITLVNSVNPYRIE 160
42781120   81 ASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVAYGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIE 160
30020104   81 ASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVAYGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIE 160
222095618  81 ASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVAYGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIE 160
218896954  81 ASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVAYGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIE 160
218234635  81 ASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVAYGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIE 160
217959475  81 ASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVAYGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIE 160
225863927  81 ASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVAYGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIE 160
118477422  87 ASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVAYGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIE 166
163939811  81 ASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVAYGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIE 160
30261998  161 GQKTAAFEICDQLQRAPDVLAIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIDEPETIATAIRI 240
42781120  161 GQKTAAFEICDQLQSAPDVLAIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIDEPETIATAIRI 240
30020104  161 GQKTAAFEICDQLQNAPDVLAIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIEEPETIATAIRI 240
222095618 161 GQKTAAFEICDQLQSAPDVLAIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIDEPETIATAIRI 240
218896954 161 GQKTAAFEICDQLQNAPDVLAIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIEEPETIATAIRI 240
218234635 161 GQKTAAFEICDQLQNAPDVLAIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIEEPETIATAIRI 240
217959475 161 GQKTAAFEICDQLQRAPDVLAIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIEEPETIATAIRI 240
225863927 161 GQKTAAFEICDQLQSAPDVLAIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGQVIEEPETIATAIRI 240
118477422 167 GQKTAAFEICDQLQSAPDVLAIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGQVIEEPETIATAIRI 246
163939811 161 GQKTAAFEICDQLQNAPDVLAIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIEAPETIATAIRI 240
30261998  241 GNPASWSYAVEAAEQSHGEIDMVSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHVQSGKIKKGETVVAVLTGNGLKD 320
42781120  241 GNPASWSYAVEAAEQSHGEIDMVSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHVQSGKIKKGETVVAVLTGNGLKD 320
30020104  241 GNPASWSYAVEAAEQSCGEIDMVSDEEILHAYRLLAKTEGVFAEPGSNASLAGVIKHVKSGKIKKGETVVAVLTGNGLKD 320
222095618 241 GNPASWSYAVEAAEQSHGEIDMVSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHVQSGKIKKGETVVAVLTGNGLKD 320
218896954 241 GNPASWSYAVEAAEQSCGEIDMVSDEEILYAYRLLAKTEGVFAEPGSNASLAGVIKHVQSGKIKEGETVVAVLTGNGLKD 320
218234635 241 GNPASWSYAVEAAEQSRGEIDMVSDEEILHAYRLLAKTEGVFAEPGSNASLAGVIKHVESGKIKKGETVVAVLTGNGLKD 320
217959475 241 GNPASWSYAVEAAEQSHGEIDMVSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHVQSGKIKKGETVVAVLTGNGLKD 320
225863927 241 GNPASWSYAVEAAQQSHGEIDMVSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHVQSGKIKKGETVVAVLTGNGLKD 320
118477422 247 GNPASWSYAVEAAQQSHGEIDMVSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHVQSGKIKKGETVVAVLTGNGLKD 326
163939811 241 GNPASWSYAVEAAEQSHGEIDMVSDEEILHAYRLLAKTEGVFAEPGSNASLAGVIKHVQSGKIKKGETVVAVLTGNGLKD 320
30261998  321 PDIAISSNTLDIASVSNNIEQIKEHIKGVIMS 352
42781120  321 PDIAISSNTLDIASVSNNIEQIKEHIKGVIMS 352
30020104  321 PDIAISSNQLDIASLSNDIEQIKDHIKGVIMS 352
222095618 321 PDIAISANTLDIASVSNNIEQIKEHIKGVIMS 352
218896954 321 PDIAISSNQLDIASLSNNIEQIKDHIKGVIMS 352
218234635 321 PDIAISSNQLDIANVSNDIEQIKDHIKGVIMS 352
217959475 321 PDIAISSNTLDIASVSNNIEQIKEHIKGVIMS 352
225863927 321 PDIAISSNTLDIASVSNNIEQIKEHIKGVIMS 352
118477422 327 PDIAISSNTLDIASVSNNIEQIKEHIKGVIMS 358
163939811 321 PDIAISSNKFDIASVSNDIEQIKDHIKGVIMS 352
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap