Conserved Protein Domain Family
PRK06714

?
PRK06714: PRK06714 
S-adenosylhomocysteine nucleosidase; Validated
Statistics
?
PSSM-Id: 168652
View PSSM: PRK06714
Aligned: 20 rows
Threshold Bit Score: 428.571
Threshold Setting Gi: 42781697
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30262555    1 MKRIAIVAAWEPELTYLHQSYPSERIEKRAAWEFHFHTINDLEIISVITGVGKVSCASCAQLLISEFQPDELFMTGICGS 80 
47778063    1 MKRIAIVAAWEPELTYLHQSYPSERIEKRAAWEFHFHTINDLEIISVITGVGKVSCASCAQLLISEFQPDELFMTGICGS 80 
227814626  10 MKRIAIVAAWEPELTYLHQSYPSERIEKRAAWEFHFHTINDLEIISVITGVGKVSCASCAQLLISEFQPDELFMTGICGS 89 
229600116  10 MKRIAIVAAWEPELTYLHQSYPSERIEKRAAWEFHFHTINDLEIISVITGVGKVSCASCAQLLISEFQPDELFMTGICGS 89 
30020631    5 MKRIAIVSAWEPELTYLHQHYPSERVEKRAAWEFHFHTINELEIISVVTGVGKVSCASCVQLLISEFQPDELFMTGICGS 84 
218897517  10 MKRIAIVSAWEPELTYLHQHYPSERVEKRAAWEFHFHTINELEIISVVTGVGKVSCASCVQLLISEFQPDELFMTGICGS 89 
218233811  10 MKRIAIVSAWEPELTYLHQHYPSERVEKRAAWEFHFHTINELEIISVVTGVGKVSCASCVQLLISEFQPDELFMTGICGS 89 
218903693   1 MKRIAIVAAWEPELTYLHQSYPSERIEKRAAWEFHFHTINDLEIISVITGVGKVSCASCAQLLISEFQPDELFMTGICGS 80 
118477959  10 MKRIAIVAAWEPELTYLHQSYPSERIEKRAAWEFHFHTINDLEIISVITGVGKVSCASCVQLLISEFQPDELFMTGICGS 89 
163940334   1 MKRIAIVSAWEPELTYLHQHYPSERVEKIAAWEFHFHSINELEVISVVTGVGKVSCASCVQLLISEFQPDQLFMTGICGS 80 
30262555   81 LSTKVKNGHIVVALNAIQHDVTAAGSGEDVFNLYNGRTAPIETTKSLVRRIKKIRSYDPIHFGTFLSGDQRIRSSEMRYL 160
47778063   81 LSTKVKNGHIVVALNAIQHDVTAAGSGEDVFNLYNGRTAPIETTKSLVRRIKKIRSYDPIHFGTFLSGDQRIRSSEMRYL 160
227814626  90 LSTKVKNGHIVVALNAIQHDVTAAGSGEDVFNLYNGRTAPIETTKSLVRRIKKIRSYDPIHFGTFLSGDQRIRSSEMRYL 169
229600116  90 LSTKVKNGHIVVALNAIQHDVTAAGSGEDVFNLYNGRTAPIETTKSLVRRIKKIRSYDPIHFGTFLSGDQRIRSSEMRYL 169
30020631   85 LSNKVKNGHIVVALNAIQHDVTAAGSGEDVFNLYNGRTAPIETTKSLVRRIKKIRSYDPIHFGTFLSGDQRIRSSEMRYL 164
218897517  90 LSNKVKNGHIVVALNAIQHDVTAAGSGEDVFNLYNGRTAPIETTKSLVRRIKKIRLYDPIHFGTFLSGDQRIRSSEMRYL 169
218233811  90 LSNKVKNGHIVVALNAIQHDVTAAGSGEDVFNLYNGRTAPIETTKSLVRRIKKIRSYDPIHFGTFLSGDQRIRSSEMRYL 169
218903693  81 LSTKVKNGHIVVALNAIQHDVTAAGSGEDVFNLYNGRTAPIETTKSLVRRIKKIRSYDPIHFGTFLSGDQRIRSSEMRYL 160
118477959  90 LSTKVKNGHIVVALNAIQHDVTAAGSGEDVFNLYNGRTAPIDTTKSLVRRIKKIRSYDPIHFGTFLSGDQRIRSSEMRYL 169
163940334  81 LSDKVKNGHIVVALNTLQHDVTAAGSGEDSFNLYDGRTAPIETTKSLVKRMKKLRSYDPVHFGTFLSGDQRIRSSEMRYL 160
30262555  161 LHTVYGALAVDQEVAAFAYVCQINKKPFLCLKAASDQANDKTKEEQKIFKMLACERACEHLIAFLRVYEINVVNHR 236
47778063  161 LHTVYGALAVDQEVAAFAYVCQINKKPFLCLKAASDQANDKTKEEQKIFKMLACERACEHLIAFLRVYEINVVNHR 236
227814626 170 LHTVYGALAVDQEVAAFAYVCQINKKPFLCLKAASDQANDKTKEEQKIFKMLACERACEHLIAFLRVYEINVVNHR 245
229600116 170 LHTVYGALAVDQEVAAFAYVCQINKKPFLCLKAASDQANDKTKEEQKIFKMLACERACEHLIAFLRVYEINVVNHR 245
30020631  165 LHTVYGALAVDQEVAAFAYVCQINKKPFLCLKAASDQANDKTKEEQKIFKMLACERACEHLIAFLRVYEINVVNNR 240
218897517 170 LHTVYGALAVDQEVAAFAYVCQINKKPFLCLKAASDQANDKTKEEQKIFKMLACERACEHLIAFLRVYEINVVNNR 245
218233811 170 LHTVYGALAVDQEVAAFAYVCQINKKPFLCLKAALDQANDKTKEEQKIFKMLACERACEHLIAFLRVYEINVVNNR 245
218903693 161 LHTVYGALAVDQEVAAFAYVCQINKKPFLCLKAASDQANDKTKEEQKIFKMLACERACEHLIAFLRVYEINVVNHR 236
118477959 170 LHTVYGALAVDQEVAAFAYVCQINKKPFLCLKAASDQANDKTKEEQKIFKMLACERACEHLIAFLRVYEINIVNNR 245
163940334 161 LHTVYGALAVDQEVAAFAYVCRVNNKPFLCLKAASDQANDKTKEEQKVFKMLACERACEHLITFLRVYEITVVNNR 236
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap