Conserved Protein Domain Family
PRK06702

?
PRK06702: PRK06702 
bifunctional O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase
Statistics
?
PSSM-Id: 102505
View PSSM: PRK06702
Aligned: 20 rows
Threshold Bit Score: 814.673
Threshold Setting Gi: 30023436
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30265427    1 MGESWGKGTICVQGGYTPKNGEPRVLPLYQSTTYKYDTSDDLAALFNLEAEGYIYTRIGNPTLAAFEQKLAELEGGVGAV 80 
42784580    1 MGESWGKGTICVQGGYTPKNGEPRVLPLYQSTTYKYDTSDDLAALFNLEAEGYIYTRIGNPTLAAFEQKLADLEGGVGAV 80 
30023436    1 -----------MQGGYTPKNGEPRVLPLYQSTTYKYDTSDDLAALFNLEAEGYIYTRIGNPTLAAFEQKLSDLEGGVGAV 69 
222098879   1 MGESWGKGTICVQGGYTPKNGEPRVLPLYQSTTYKYDTSDDLAALFNLEAEGYIYTRIGNPTLAAFEQKLADLEGGVGAV 80 
218900533   1 MGESWGKGTICVQGGYTPKNGEPRVLPLYQSTTYKYDTSDDLAALFNLEAEGYIYTRIGNPTLAAFEQKLSDLEGGVGAV 80 
218234453   1 MGESWGKGTICVQGGYTPKNGEPRVLPLYQSTTYKYDTSDDLAALFNLEAEGYIYTRIGNPTLAAFEQKLSDLEGGVGAV 80 
217962896   1 MGESWGKGTICVQGGYTPKNGEPRVLPLYQSTTYKYDTSDDLAALFNLEAEGYIYTRIGNPTLAAFEQKLADLEGGVGAV 80 
118480438   1 MGESWGKGTICVQGGYTPKNGEPRVLPLYQSTTYKYDTSDDLAALFNLEAEGYIYTRIGNPTLAAFEQKLAELEGGVGAV 80 
296505828   1 MGESWGKGTICVQGGYTPKNGEPRVLPLYQSTTYKYDTSDDLAALFNLEAEGYIYTRIGNPTLAAFEQKLSDLEGGVGAV 80 
49480445    1 MGESWGKGTICVQGGYTPKNGEPRVLPLYQSTTYKYDTSDDLAALFNLEAEGYIYTRIGNPTLAAFEQKLAELEGGVGAV 80 
30265427   81 ATASGQAAIMLAVLNICSSGDHLLCSSTVYGGTFNLFGVSLRKLGIDVTFFNPNLTADEIVALANDKTKLVYAESLGNPA 160
42784580   81 ATASGQAAIMLAVLNICSSGDHLLCSSTVYGGTFNLFGVSLRKLGIDVTFFNPNLTADEIVALANDKTKLVYAESLGNPA 160
30023436   70 ATASGQAAIMLAVLNICSSGDHLLCSSTVYGGTFNLFGVSLRKLGIDVTFFNPNLTADEITALANDKTKLIYAESLGNPA 149
222098879  81 ATASGQAAIMLAVLNICSSGDHLLCSSTVYGGTFNLFGVSLRKLGIDVTFFNPNLTADEIVALANDKTKLVYAESLGNPA 160
218900533  81 ATASGQAAIMLAVLNICSSGDHLLCSSTVYGGTFNLFGVSLRKLGIDVTFFNPNLTADEIAALANDKTKLIYAESLGNPA 160
218234453  81 ATASGQAAIMLAVLNICSSGDHLLCSSTVYGGTFNLFGVSLRKLGIDVTFFNPNLTADEITALANDKTKLIYAESLGNPA 160
217962896  81 ATASGQAAIMLAVLNICSSGDHLLCSSTVYGGTFNLFGVSLRKLGIDVTFFNPNLTADEIVALANDKTKLVYAESLGNPA 160
118480438  81 ATASGQAAIMLAVLNICSSGDHLLCSSTVYGGTFNLFGVSLRKLGIDVTFFNPNLTADEIVALANDKTKLVYAESLGNPA 160
296505828  81 ATASGQAAIMLAVLNICSSGDHLLCSSTVYGGTFNLFGVSLRKLGIDVTFFNPNLTTDEITALANDKTKLIYAESLGNPA 160
49480445   81 ATASGQAAIMLAVLNICSSGDHLLCSSTVYGGTFNLFGVSLRKLGIDVTFFNPNLTADEIVALANDKTKLVYAESLGNPA 160
30265427  161 MNVLNFKEFSDAAKELEVPFIVDNTLATPYLCQAFEHGANIIVHSTTKYIDGHASSLGGIVIDGGNFDWTNGKYPELVEP 240
42784580  161 MNVLNFKELSDAAKELEVPFIVDNTLATPYLCQAFEHGANIIVHSTTKYIDGHASSLGGIVIDGGNFDWTNGKYPELVEP 240
30023436  150 MNVLNFKEFSAAAKELEVPFIVDNTLATPYLCQAFEYGANIIVHSTTKYIDGHASSLGGIVIDGGNFDWTNGKYPELVEP 229
222098879 161 MNVLNFKELSDAAKELEVPFIVDNTLATPYLCQAFEHGANIIVHSTTKYIDGHASSLGGIVIDGGNFDWTNGKYPELVEP 240
218900533 161 MNVLNFKEFSDAAKELEVPFIVDNTLATPYLCQAFEHGANIIVHSTTKYIDGHASSLGGIVIDGGNFDWTNGKYPELVEP 240
218234453 161 MNVLNFKEFSAAAKELEVPFIVDNTLATPYLCQAFEHGANIIVHSTTKYIDGHASSLGGIVIDGGNFDWTNGKYPELVEP 240
217962896 161 MNVLNFKELSDAAKELEVPFIVDNTLATPYLCQAFEHGANIIVHSTTKYIDGHASSLGGIVIDGGNFDWTNGKYPELVEP 240
118480438 161 MNVLNFKEFSDAAKELEVPFIVDNTLATPYLCQAFEHGANIIVHSTTKYIDGHASSLGGIVIDGGNFDWTNGKYPELVEP 240
296505828 161 MNVLNFKEFSAAAKELEVPFIVDNTLATPYLCQAFEHGANIIVHSTTKYIDGHASSLGGIVIDGGNFDWTNGKYPELVEP 240
49480445  161 MNVLNFKEFSDAAKELEVPFIVDNTLATPYLCQAFEHGANIIVHSTTKYIDGHASSLGGIVIDGGNFDWTNGKYPELVEP 240
30265427  241 DPSYHGVSYVQNFGAAAYIVKARVQLLRDYGNCMSPFNAYISNIGLETLHLRMERHSENALAVAKWLADHERIEWVNYPG 320
42784580  241 DPSYHGVSYVQNFGAAAYIVKARVQLLRDYGNCMSPFNAYISNIGLETLHLRMERHSENALAVAKWLADHERIEWVNYPG 320
30023436  230 DPSYHGVSYVQNFGAAAYIVKARVQLLRDYGNCMSPFNAYISNIGLETLHLRMERHSENALAVAKWLANHERIEWVNYPG 309
222098879 241 DPSYHGVSYVQNFGAAAYIVKARVQLLRDYGNCMSPFNAYISNIGLETLHLRMERHSENALAVAKWLADHERIEWVNYPG 320
218900533 241 DPSYHGVSYVQNFGAAAYIVKARVQLLRDYGNCMSPFNAYISNIGLETLHLRMERHSENALVVAKWLANHERIEWVNYPG 320
218234453 241 DPSYHGVSYVQNFGAAAYIVKARVQLLRDYGNCMSPFNAYISNIGLETLHLRMERHSENALAVAKWLANHERIEWVNYPG 320
217962896 241 DPSYHGVSYVQNFGAAAYIVKARVQLLRDYGNCMSPFNAYISNIGLETLHLRMERHSENALAVAKWLADHERIEWVNYPG 320
118480438 241 DPSYHGVSYVQNFGAAAYIVKARVQLLRDYGNCMSPFNAYISNIGLETLHLRMERHSENALAVAKWLADHERIEWVNYPG 320
296505828 241 DPSYHGVSYVQNFGAAAYIVKARVQLLRDYGNCMSPFNAYISNIGLETLHLRMERHSENALAVAKWLANHERIEWVNYPG 320
49480445  241 DPSYHGVSYVQNFGAAAYIVKARVQLLRDYGNCMSPFNAYISNIGLETLHLRMERHSENALAVAKWLADHGRIEWVNYPG 320
30265427  321 LDSNENYSLAQKYLKKGASGVLTFGIKGGLEAAKEFIANVKLATLVTHVADARTCVIHPASTTHRQLSAEDQRLAGVTSD 400
42784580  321 LDSNENYSLAQKYLKRGASGVLTFGIKGGLEAAKEFIANVKLATLVTHVADARTCVIHPASTTHRQLSAEDQRLAGVTSD 400
30023436  310 LDSNENYSLAQQYLKKGASGVLTFGIKGGLEAAKEFIANVKLATLVTHVADARTCVIHPASTTHRQLNAEDQRLAGVTSD 389
222098879 321 LNSNENYSLAQKYLKKGASGVLTFGIKGGLEAAKEFISNVKLATLVTHVADARTCVIHPASTTHRQLSAEDQRLAGVTSD 400
218900533 321 LDSNENYSLAQTYLKKGASGVLTFGIKGGLEAAKEFIANVKLATLVTHVADARTCVIHPASTTHRQLSAEDQRLAGVTSD 400
218234453 321 LDSNENYSLAQQYLKKGASGVLTFGIKGGLEAAKEFIANVKLATLVTHVADARTCVIHPASTTHRQLNAEDQRLAGVTSD 400
217962896 321 LNSNENYSLAQKYLKKGASGVLTFGIKGGLEAAKEFISNVKLATLVTHVADARTCVIHPASTTHRQLSAEDQRLAGVTSD 400
118480438 321 LDSNENYSLAQKYLKKGASGVLTFGIKGGLEAAKEFIANVKLATLVTHVADARTCVIHPASTTHRQLSAEDQRLAGVTSD 400
296505828 321 LDSNENYSLAQQYLKKGASGVLTFGIKGGLEAAKEFIANVKLATLVTHVADARTCVIHPASTTHRQLNAEDQRLAGVTSD 400
49480445  321 LDSNENYSLAQKYLKKGASGVLTFGIKGGLEAAKEFIANVKLATLVTHVADARTCVIHPASTTHRQLSAEDQRLAGVTSD 400
30265427  401 LIRLSVGIEDVSDIIADLEAALVGGKQHADHN 432
42784580  401 LIRLSVGIEDVSDIIADLEAALVGGKQHADHN 432
30023436  390 LIRLSVGIEDVSDIIADLEAALVGGKTHANHN 421
222098879 401 LIRLSVGIEDVSDIIADLEAALVGGKQHADHN 432
218900533 401 LIRLSVGIEDVSDIIADLEAALVGGKEHADHN 432
218234453 401 LIRLSVGIEDVSDIIADLEAALVGGKTHADHN 432
217962896 401 LIRLSVGIEDVSDIIADLEAALVGGKQHADHN 432
118480438 401 LIRLSVGIEDVSDIIADLEAALVGGKQHADHN 432
296505828 401 LIRLSVGIEDVSDIIADLEAALVGGKTHADHN 432
49480445  401 LIRLSVGIEDVFDIIADLEAALVGGKQHADHN 432
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap