Conserved Protein Domain Family
PRK06698

?
PRK06698: PRK06698 
bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated
Statistics
?
PSSM-Id: 136007
View PSSM: PRK06698
Aligned: 8 rows
Threshold Bit Score: 896.679
Threshold Setting Gi: 218897944
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30262830    1 MNRIGIIGAMQIEIDLLLEKLIMQEEQIIAGMPFYVGEFMGTEVIVTRCGVGKVNAAACTQTLIHKFDVDAIINTGVAGG 80 
47528161    1 MNRIGIIGAMQIEIDLLLEKLIMQEEQIIAGMPFYVGEFMGTEVIVTRCGVGKVNAAACTQTLIHKFDVDAIINTGVAGG 80 
42781953    1 MNRIGIIGAMQIEIDLLLEKLAIQEKQTIAGMPFYVGEFMGMEVIVTRCGVGKVNAAACTQTLIHKFDVDAIINTGVAGG 80 
118478213   1 MNRIGIIGAMQIEIDLLLEKLIMQEEQIIAGMPFYVGEFMGTEVIVTRCGVGKVNAAACTQILIHKFDVDAIINTGVAGG 80 
218897944   1 MNRIGIIGAMQIEIDLLLEKLVIQEEQTIAGMPFYIGEFMGIEVIITRSGVGKVNAAACAQTLIHKFDVDSIINTGVAGG 80 
225864839   1 MNRIGIIGAMQIEIDLLLEKLIMQEEQIIAGMPFYVGEFMGTEVIVTRCGVGKVNAAACTQTLIHKFDVDAIINTGVAGG 80 
227814324   1 MNRIGIIGAMQIEIDLLLEKLIMQEEQIIAGMPFYVGEFMGTEVIVTRCGVGKVNAAACTQTLIHKFDVDAIINTGVAGG 80 
229220842   1 MNRIGIIGAMQIEIDLLLEKLIMQEEQIIAGMPFYVGEFMGTEVIVTRCGVGKVNAAACTQTLIHKFDVDAIINTGVAGG 80 
30262830   81 LHPDVKVGDIVISTNVTHHDVSKTQMKNLFPFQEEFIASKELVELARKACNSSSLHMEIHEGRIVSGECFVEDSKLKAKL 160
47528161   81 LHPDVKVGDIVISTNVTHHDVSKTQMKNLFPFQEEFIASKELVELARKACNSSSLHMEIHEGRIVSGECFVEDSKLKAKL 160
42781953   81 LHPDVKVGDVVISTNVTHHDVSKTQMKNLFPFQEEFHASKKLMELARTACNSSSLHIGVHEGRIVSGECFVEDSKLKAKL 160
118478213  81 LHPDVKVGDIVISTNVTHHDVSKTQMKNLFPFQEEFIASKELVELARKACNSSSLHMEIHEGRIVSGECFVEDSKLKAKL 160
218897944  81 LHPDVKVGDLVISTNVTHHDVSKNQMKNLFPFKEEFIASKELVELARKACNSSSLRTRVHEGRIVSGECFVEDSKLKAKL 160
225864839  81 LHPDVKVGDIVISTNVTHHDVSKTQMKNLFPFQEEFIASKELVELARKACNSSSLHMEIHEGRIVSGECFVEDSKLKAKL 160
227814324  81 LHPDVKVGDIVISTNVTHHDVSKTQMKNLFPFQEEFIASKELVELARKACNSSSLHMEIHEGRIVSGECFVEDSKLKAKL 160
229220842  81 LHPDVKVGDIVISTNVTHHDVSKTQMKNLFPFQEEFIASKELVELARKACNSSSLHMEIHEGRIVSGECFVEDSKLKAKL 160
30262830  161 IDEYAPHCTEMEGAAIGHVAYINEVPFLVIRCISDSADDEAQISYDDFAKTAANYCSEIIVEMLKTISSKTYSSKGENEM 240
47528161  161 IDEYAPHCTEMEGAAIGHVAYINEVPFLVIRCISDSADDEAQISYDDFAKTAANYCSEIIVEMLKTISSKTYSSKGENEM 240
42781953  161 IDEYAAHCTEMEGAAIGHVAYINEVPFLVIRCISDSADDEAQISYDDFAKTAANYCSEIIVEMLKNISSKTYSSKGGNEM 240
118478213 161 IDEYAPHCTEMEGAAIGHVAYINEVPFLVIRCISDSADDEAQISYDNFAKTAANYCSEIIVEMLKTISSKTYSSKGENEM 240
218897944 161 IDEYAPHCTEMEGAAIGHVAYINDIPFLVIRCISDSADDEAQVSYDDFAKTAANYCSEIIVEMLKNISSNTYSSKGENDM 240
225864839 161 IDEYAPHCTEMEGAAIGHVAYINEVPFLVIRCISDSADDEAQISYDDFAKTAANYCSEIIVEMLKTISSKTYSSKGENEM 240
227814324 161 IDEYAPHCTEMEGAAIGHVAYINEVPFLVIRCISDSADDEAQISYDDFAKTAANYCSEIIVEMLKTISSKTYSSKGENEM 240
229220842 161 IDEYAPHCTEMEGAAIGHVAYINEVPFLVIRCISDSADDEAQISYDDFAKTAANYCSEIIVEMLKTISSKTYSSKGENEM 240
30262830  241 LQALIFDMDGTLFQTDKILELSLDDTFDHLRSLQLWDTVTPIDKYREIMGVPLPKVWEALLPDHSLEIREQTDAYFLERL 320
47528161  241 LQALIFDMDGTLFQTDKILELSLDDTFDHLRSLQLWDTVTPIDKYREIMGVPLPKVWEALLPDHSLEIREQTDAYFLERL 320
42781953  241 LQAFIFDMDGTLFQTDKILELSLDDTFDHLRSLQLWDTVTPIEKYREIMGVPLPKVWETLLPNHSIEVREQTDAYFLERL 320
118478213 241 LQALIFDMDGTLFQTDKILELSLDDTFDHLRSLQLWDTVTPIDKYREIMGVPLPKVWEALLPDHSLEIREQTDAYFLERL 320
218897944 241 LQALIFDMDGTLFQTDKILELSLDDTFNHLRSLQLWDTVTPINKYREIMGVPLPQVWEALLPDHSIEVREQTDAYFLDRL 320
225864839 241 LQALIFDMDGTLFQTDKILELSLDDTFDHLRSLQLWDTVTPIDKYREIMGVPLPKVWEALLPDHSLEIREQTDAYFLERL 320
227814324 241 LQALIFDMDGTLFQTDKILELSLDDTFDHLRSLQLWDTVTPIDKYREIMGVPLPKVWEALLPDHSLEIREQTDAYFLERL 320
229220842 241 LQALIFDMDGTLFQTDKILELSLDDTFDHLRSLQLWDTVTPIDKYREIMGVPLPKVWEALLPDHSLEIREQTDAYFLERL 320
30262830  321 IENIKSGKGALYPNVKEIFTYIKENNCSIYIASNGLTEYLRAIVSYYDLDQWVTETFSIEQINSLNKSDLVKSILNKYDI 400
47528161  321 IENIKSGKGALYPNVKEIFTYIKENNCSIYIASNGLTEYLRAIVSYYDLDQWVTETFSIEQINSLNKSDLVKSILNKYDI 400
42781953  321 IENIKSGKGALYPNVKEIFTYIKENNCSIYIASNGLTEYLRAIVSYYALDQWVTETFSIEQINSLNKSDLVKSILNKYDI 400
118478213 321 IENIKSGKGALYPNVKEIFTYIKENNCSIYIASNGLTEYLRAIVSYYDLDQWVTETFSIEQINSLNKSDLVKSILNKYDI 400
218897944 321 IENIKSGKGALYSNVKEIFTYIKENNCSIYIASNGLTEYLRAIVTYYALDKWVTETFSIEQIQSLNKGDLVKSIMNKYDI 400
225864839 321 IENIKSGKGALYPNVKEIFTYIKENNCSIYIASNGLTEYLRAIVSYYDLDQWVTETFSIEQINSLNKSDLVKSILNKYDI 400
227814324 321 IENIKSGKGALYPNVKEIFTYIKENNCSIYIASNGLTEYLRAIVSYYDLDQWVTETFSIEQINSLNKSDLVKSILNKYDI 400
229220842 321 IENIKSGKGALYPNVKEIFTYIKENNCSIYIASNGLTEYLRAIVSYYDLDQWVTETFSIEQINSLNKSDLVKSILNKYDI 400
30262830  401 KEAAVVGDRLSDINAAKDNGLIAIGCNFDFAQEDELAQADIVIDDLLELKEILSTVQRL 459
47528161  401 KEAAVVGDRLSDINAAKDNGLIAIGCNFDFAQEDELAQADIVIDDLLELKEILSTVQRL 459
42781953  401 KEAAIVGDRLSDINAAKDNGLFAIGCNFDFAQEDELVQADIVIDDLMELKGILPAVQR- 458
118478213 401 KEAAVVGDRLSDINAAKDNGLIAIGCNFDFAQEDELAQADIVIDDLLELKGILSTVQRL 459
218897944 401 KEAAVVGDRLSDINAAKDNGLLAIGCNFDFAQEDELAQADIVIDDLMELKGILSEVKNT 459
225864839 401 KEAAVVGDRLSDINAAKDNGLIAIGCNFDFAQEDELAQADIVIDDLLELKGILSTVQRL 459
227814324 401 KEAAVVGDRLSDINAAKDNGLIAIGCNFDFAQEDELAQADIVIDDLLELKGILSTVQRL 459
229220842 401 KEAAVVGDRLSDINAAKDNGLIAIGCNFDFAQEDELAQADIVIDDLLELKEILSTVQRL 459
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap