Conserved Protein Domain Family
PRK06673

?
PRK06673: PRK06673 
DNA polymerase III subunit beta; Validated
Statistics
?
PSSM-Id: 135998
View PSSM: PRK06673
Aligned: 19 rows
Threshold Bit Score: 702.965
Threshold Setting Gi: 218897702
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30262664    1 MEFIVNHKHFTQALSDVSKAISTKAIIPILSGIKITADQSGITLIASNSNIFIEKFIPSAIDDEQITTILQAGTIVVPAK 80 
229604660   1 MEFIVNHKHFTQALSDVSKAISTKAIIPILSGIKITADQSGITLIASNSNIFIEKFIPSAIDDEQITTILQAGTIVVPAK 80 
42781777    1 MEFIVNHKHFTQALSEVSKAISTKAFIPILSGIKITANQSGITLIASNSNIFIEKFIPSSMDDEQITTTLQAGTIVVPAK 80 
30020817    1 MEFIVNHKQFTQALSEVNKAISTKFLIPILSGIKITADQSGITLIASNSNIFIEKFIPVLIEDEKIATILKAGTIVVPAK 80 
222096204   1 MEFIVNHKHFTQALSEVSKAISTKAIIPILSGIKITADQSGITLIASNSNIFIEKFIPSSMDDEQITTTLKAGTIVVPAK 80 
218897702   1 MEFIVNHKQFTQALSEVNKAISTKSLIPILSGIKITADQSGITLIASNSNIFIEKFIPVSIEDEKIATILKAGTIVVPAK 80 
218233276   1 MEFIVNHKQFTQALSEVNKAISTKSLIPILSGIKITADQSGITLIASNSNIFIEKFIPVLIEDEKIATILKAGTIVVPAK 80 
217960140   1 MEFIVNHKHFTQALSEVSKAISTKAIIPILSGIKITADQSGITLIASNSNIFIEKFIPSSMDDEQITTTLKAGTIVVPAK 80 
301054217   1 MEFIVNHKHFTQALSDVSKAISTKAIIPILSGIKITADQSGITLIASNSNIFIEKFIPSAIDDEQITTILQVGTIVVPAK 80 
296503248   1 MEFIVNHKQFTQALSEVNKAISTKSLIPILSGIKITADQSGITLIASNSNIFIEKFIPVLIEDEKIATILKAGTIVVPAK 80 
30262664   81 YFIEIIKKMPSDIVIKSKNEQTITIQSGEITLNLNGFPANEFPNVPQIDDHTEIQIETKQLIDAFKQTVFAVAKNESRHV 160
229604660  81 YFIEIIKKMPSDIVIKSKNEQTITIQSGEITLNLNGFPANEFPNVPQIDDHTEIQIETKQLIDAFKQTVFAVAKNESRHV 160
42781777   81 YFIEIIKKMPSDIVIKSKNEQTITIQSEEITLNLNGFPASEFPNVPQIEDHAEIQIETKQLIDAFKQTVFAVAKNESRPV 160
30020817   81 YFIEIIKKMPSDIAIKSKNEQIIKIQSEEITLSLNGFPADEFPNVPLIDNHAEIKVETEQLIEVFKQTVFAVAKNESRPV 160
222096204  81 YFIEIIKKMPSDIVIKSKNEQTITIQSEEITLNLNGFPANEFPNVPQIDDHAEIQIETKQLIDAFKQTVFAVAKNESRPV 160
218897702  81 YFIEIIKKMPSDIAIKSKNEQIIKIQSEEITLSLNGFPADEFPNVPLIDNHAEIKVETEQLIEVFKQTVFAVAKNESRPV 160
218233276  81 YFIEIIKKMPSDIAIKSKNEQLITIQSEEIILSLNGFPADEFPNVPLIDNHAEIKVETEQLIEVFKQTVFAVAKNESRPV 160
217960140  81 YFIEIIKKMPSDIVIKSKNEQTITIQSEEITLNLNGFPANEFPNVPQIDDHAEIQIETKQLIDAFKQTVFAVAKNESRPV 160
301054217  81 YFIEIIKKMPSDIVIKSKNEQTITIQSGEITLNLNGFPVNEFPNVPQIDDHTEIQIETKQLIDAFKQTVFAVAKNESRPV 160
296503248  81 YFIEIIKKMPSDIAIKSKNEQIIKIQSEEITLSLNGFPADEFPNVPLIDNHAEIKVETEQLIEVFKQTVFAVAKNESRPV 160
30262664  161 LTGVHIELDHNKLICAATDSHRLAIRETLISTNMKANCIVPSATINELLKLMNSNLEFVSIYLSESHIIFTFGTTTLYSR 240
229604660 161 LTGVHIELDHNKLICAATDSHRLAIRETLISTNMKANCIVPSATINELLKLMNSNLEFVSIYLSESHIIFTFGTTTLYSR 240
42781777  161 LTGVHIELDYNKLICAATDSHRLAIRETQISTNMKANCIVPSATINELLKLMNSNLEFVSIYLSESHIIFTFGTTTLYSR 240
30020817  161 LTGVHIELSNNKLICAATDSHRLAIRETLLSSDVKANCIVPSATINELLKLMNSNSEFVYIYFSESHIIFTFGTTTLYSR 240
222096204 161 LTGVHIELDHNKLICAATDSHRLAIRETLISTNMKANCIVPSATINELLKLMNSNLEFVSIYLSESHIIFTFGTTTLYSR 240
218897702 161 LTGVHIELSNNKFICAATDSHRLAIRETRLSSDVKANCIVPSATISELLKLMNSNSEFVYIYLSESHIIFTLGTTTLYSR 240
218233276 161 LTGVHIELSNNKLICAATDSHRLAIRETLLSSDVKANCIVPSATISELLKLMNSNSEFVYIYLSESHIIFTLGTTTLYSR 240
217960140 161 LTGVHIELDHNKLICAATDSHRLAIRETLISTNMKANCIVPSATINELLKLMNSNLEFVSIYLSESHIIFTFGTTTLYSR 240
301054217 161 LTGVHIELDHNKLICAATDSHRLAIRETLISTNMKANCIVPSATINELLKLMNSNLEFVSIYLSESHIIFTFGTTTLYSR 240
296503248 161 LTGVHIELSNNKFICAATDSHRLAIRETRLSSDVKANCIVPSATINELLKLMNSNSKFVYIYLSESHIIFTLGTTTLYSR 240
30262664  241 LIEGKYPNISTLIPNEFQTVINIDRQRMLQGVDRSSLLASEWANNNVNLEIVNESTIQISSNASQIGKISEKQQIDVIQG 320
229604660 241 LIEGKYPNISTLIPNEFQTVINIDRQRMLQGVDRSSLLASEWANNNVNLEIVNESTIQISSNASQIGKISEKQQIDVIQG 320
42781777  241 LIEGKYPNISSLIPNEFQTVINVDRQRMLQGVDRSSLLASEWANNNVNLEIVNESTIKVSSNASQIGKIYETQQVDAIHG 320
30020817  241 LIEGKYPNISNLIPNDFKTIINVDRKKILQGVDRSSLLASEWANNNVNLEIINESTIKISSNASQIGKISETQQIDAIQG 320
222096204 241 LIEGKYPNISTLIPNEFQTVINIDRQRMLQGVDRSSLLASEWANNNVNLEIVNESTIQISSNASQIGKISETQQIDAIQG 320
218897702 241 LIEGKYPNISNLIPNDFKTIINIDRKKILQGVDRSSLLASEWANNNVNLEIINESTIKISSNASQIGQISETQQIDAIQG 320
218233276 241 LIEGKYPNISNLIPNDFKTIINIDRKKVLQGVDRSSLLASEWANNNVNLEIINESTIKISSNASQIGQISETQQIDAIQG 320
217960140 241 LIEGKYPNISTLIPNEFQTVINIDRQRMLQGVDRSSLLASEWANNNVNLEIVNESTIQISSNASQIGKISETQQIDAIQG 320
301054217 241 LIEGKYPNISTLIPNEFQTVINIDRQRMLQGVDRSSLLASEWANNNVNLEIVNESTIQISSNASQIGKISETQQIDGLQG 320
296503248 241 LIEGKYPNISNLIPNDFKTIINVDRKKILQGVDRSSLLASEWANNNVNLEIINESTIKISSNASQIGKISETQQIDAIQG 320
30262664  321 KKQLNISFDGRFMLDALRAIKEETVTLSFSGSMRPILIEAGTQSAAIHLISPVRAY 376
229604660 321 KKQLNISFDGRFMLDALRAIKEETVTLSFSGSMRPILIEAGTQSAAIHLISPVRAY 376
42781777  321 EKQLHISFDGRFMLDALRAIKEETVTLSFSGSMRPILIEAGTQSAAIHLISPVRAY 376
30020817  321 EKQLNISFDGRFMVDALRAIKEETITLSFGGSMRPILIEAGEQSAAVHLISPVRAY 376
222096204 321 EKQFNISFDGRFMLDALRAIKEETVTLSFSGSMRPILIEAGTQCAAIHLISPVRAY 376
218897702 321 EKQLNISFDGRFMVDALRAIKEETITLSFGGSMRPILIEAGEQSAAIHLISPVRAY 376
218233276 321 EKQLNISFDGRFMVDALRAIKEEKITLSFGGSMRPILIEAGEQSAAVHLISPVRAY 376
217960140 321 EKQFNISFDGRFMLDALRAIKEETVTLSFSGSMRPILIEAGTQCAAIHLISPVRAY 376
301054217 321 EKQLNISFDGRFMVEALKAIKEETITLSFGGSMRPILIEAGEQSAVVHLISPVRAY 376
296503248 321 EKQLNISFDGRFMVDALRAIKEETITLSFGGSMRPILIEAGEQSAAVHLISPVRAY 376
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap