Conserved Protein Domain Family
PRK06661

?
PRK06661: PRK06661 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 168637
View PSSM: PRK06661
Aligned: 14 rows
Threshold Bit Score: 425.4
Threshold Setting Gi: 254797181
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15892601    1 MDIKYNLAAAYRIMAYLSLDDHTYTHLSARPKNAVFYYIYPFGLRFEEVTTENLLKVSLDGQILEGEEYQYNKTGYFIHG 80 
15604353    1 MDIKYNLAAAYKIMAYLSLDDHTYTHLSARSKNADFYYIYPFGLRFEEVTTENLLKVSLDGKILEGEEYQYNKTGYFIHG 80 
157828548   1 MDIKYNLAAAYRIMAYLSLDDHTYTHLSARPKNAVFYYIYPFGLRFEEVTTENLLKVSLDGQILEGEEYQYNKTGYFIHG 80 
51473676    1 MDIKYNLAAAYRIMAYLSLDDHTYTHLSARSKNADFYYIYPFGLRFEEVTTENLLKVSLDGKILEGEEYQYNKTGYFIHG 80 
254797181   4 FTLKKDLLYAYRIIGHLGMDDLTYTHITVRPEGADFFYIAKFGVLFNQVTFDDLIKVSLDGEILEGKEVTYNKTAYTIHG 83 
225630032   5 SRVKRDLVYAYQILSYLKFDDHTYTHLSVRSEDQKSFYIYPFGMRFDEVDERSLMKVSFDGDVVEGKEYQYNRTGYIIHG 84 
42520104    6 SRVKRDLVYAYQILSYLKFDDHTYTHLSVRSEDQKSFYIYPFGMRFDEVDERSLMKVSFDGDVIEGKEYQYNRTGYIIHG 85 
91205767    2 TNVKYNLAAAYKIMAYLSMDDHTYTHLSARPKDADFYYIYPFGLRFEEVTEHNLLKVSLDGRILEGEEYQYNKTGYFIHG 81 
157827106   2 TNVKYNLAAAYKIMAYLSMDDHTYTHLSARPKDADFYYIYPFGLRFEEVTEHNLLKVSLDGRILEGEEYQYNKTGYFIHG 81 
238650240   1 MDIKYNLAAAYRIMAYLSLDDHTYTHLSARPKNAVFYYIYPFGLRFEEVTTENLLKVSLDGQILEGEEYQYNKTGYFIHG 80 
15892601   81 SIYKTRPDISAIFHYHTPAAIAVSALKCGLLPISQWALHFYDRISYHNYNSLVLDADKQSSRLVTDLKQNYVMLLRNHGA 160
15604353   81 NIYKARPDVLAIFHYHTPASTAVSALKCGLLPISQWALHFYDRISYHDYNSLVLDADKQSTKFVNDLKQNYVMLLRNHGA 160
157828548  81 SIYKTRPDISAIFHYHTPAAIAVSALKCGLLPISQWALHFYDRISYHNYNSLVLDADKQSSRLVTDLKQNYVMLLRNHGA 160
51473676   81 SIYKARPDVFAIFHYHTPASIAVSSLKCGLLPISQWALHFYDRISYHDYNSLVLDAG-QSAKFVNDLKQNYVMLLRNHGA 159
254797181  84 SVYNSRSDVNAVYHLHTQASIVVSVMECGLLPLSQFAMPFFENISYYEYDSLALDKAIQGTDLAMSLGSNKAMLMRSHGL 163
225630032  85 FVYQARKDIQAIFHLHTPSIVAVSSLKDGLLPISQWALHFYNKISYHNYNSLAL-SDTEGKRLIADLKENFVMLMRNHGS 163
42520104   86 FVYQARKDIQAIFHLHTPSIVAASSLKDGLLPISQWALHFYNKISYHNYNSLAL-SDTEGKRLIADLKENFVMLMRNHGS 164
91205767   82 SIYQTRPDISAIFHYHTPASIAVSALKCGLLPISQWALHFYNRISYHEYNSLILDSEKQSDRLVNDLKQNYVMLLRNHGA 161
157827106  82 SIYQTRPDISAIFHYHTPASIAVSALKCGLLPISQWALHFYNRISYHEYNSLILDSEKQSDRLVNDLKQNYVMLLRNHGA 161
238650240  81 SIYKTRPDISAIFHYHTPAAIAVSALKCGLLPISQWALHFYDRISYYNYNSLVLDADKQSSRLVTDLKQNYVMLLRNHGA 160
15892601  161 ITCGKTIHEAMFYTYHLEQACKTQCLLNSTKEQELIIPSVEICKQTVKDLLSFEEDLGKRDWAAWLRLVKM 231
15604353  161 ITCGKTIHEAMFYTYHLEQACKTQCLLNSTIQQELIIPSVEICKKTVKDLLSFEEDLGKRDWEAWLRLINM 231
157828548 161 ITCGKTIHEAMFYTYHLEQACKTQCLLNSTKEQELIIPSVEICKQTVKDLLSFEEDLGKRDWAAWLRLVKM 231
51473676  160 IICGKTIHEAMFYTYHLEQACKTQCLLNSTIQQELIIPSVEICKKTVKDLLSFEEDLGKRDWEAWLRLINM 230
254797181 164 LTCGNNLQEALFYTRFLEQACRIQVAVLST-KQKYILPGSHICRKARQDMLTFEERLGERDWKALSKLLEG 233
225630032 164 IMCGRSIQEAMFYTYHLEQACKTQCLTLAM-NKELSIPSEEICSKAVKDLLSFESNLGERDWHAWVRLIKS 233
42520104  165 ITCGRTIQEAMFYSYHLEQACKTQCLTLAM-NKELSIPSEEICSKAVKDLLSFESNLGERDWHAWVRLIKS 234
91205767  162 ITCGKTIHEAMFYAYHLEQACKTQCSLNSANKQDLIIPSEEICKQTVKDLLSFEEDLGKCDWDAWLRVIKN 232
157827106 162 ITCGKTIHEAMFYAYHLEQACKTQCSLNSANKQDLIIPSEEICKQTVKDLLSFEEDLGKCDWDAWLRVIKN 232
238650240 161 ITCGKTIHEAMFYTYHLEQACKTQCLLNSTKEQELIIPSVEICKQTVKDLLSFEEDLGKRDWAAWLRLVKM 231
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap