Conserved Protein Domain Family
PRK06646

?
PRK06646: PRK06646 
DNA polymerase III subunit chi; Provisional
Statistics
?
PSSM-Id: 102480
View PSSM: PRK06646
Aligned: 13 rows
Threshold Bit Score: 272.617
Threshold Setting Gi: 157826359
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15893269    1 MQQFSIYQTSDELLLKSILLLIEKCYHSDLKSVILTADADQQEMLNKNLWTYSRKQFIPHGSKLDPQPEKQPIYITDELQ 80 
161729084   1 MQQFSIYHTSNELFLKAILRLIEKCYYSNFKSVILTTDVHQQEMLNKNLWTYSRKQFIPHGSKFDPQPAKQPIYITDELQ 80 
157829183   1 MQQFSIYQTSDELLLKSILLLIEKCYHSDLKSVILTADADQQEMLNKNLWTYSRKQFIPHGSKLDPQPEKQPIYITDELQ 80 
165933911   1 MQQFSIYQTSDELLLKSILLLIEKCYHSDLKSVILTADADQQEMLNKNLWTYSRKQFIPHGSKLDPQPEKQPIYITDELQ 80 
51474041    1 MQQFSIYHTSDELLLKAILCLLEKCYYSDLKSVILTTDVDQQEMLNKNLWTYSRKQFIPHGSKFDPQPTKQPIYITDELQ 80 
157826359   1 MQQFSIYQTSDELLLKSILLLIEKCYHYDLKSVILTTDADQQEMLNKHLWTYSRKQFIPHGSKLDPQPEKQPIYITDELQ 80 
157804263   1 MQQFSIYQTSDELLLKSVLLLIEKCYYSDLKSVILTTDKEQQEMLNKNLWTYSRKQFIPHGSKLDPQPEKQPIYITDELQ 80 
91206236    1 MQQFSIYQTSDELLLKAIFLLIEKCYYSDLKSVVLTVDTEQQEMLNKNLWTYSRKQFIPHGSKVDPQPEKQPIYITDTLQ 80 
157827852   1 MQQFSIYQTSDELLLKAIFLLIEKCYYSDLKSVVLTVDTEQQEMLNKNLWTYSRKQFIPHGSKVDPQPEKQPIYITDTLQ 80 
229587243   1 MQQFSIYQTSDELLLKSILLLIEKCYHSDLKSVILTADADQQEMLNKNLWTYSRKQFIPHGSKLDPQPEKQPIYITDELQ 80 
157965013   3 MQQFSIYQTSDELLLKSILLLIEKCYYSDLKSVILTADADQQEMLNKNLWTYSRKQFIPHGSKLDPQPEKQPIYITDELQ 82 
67459767    1 MQQFSIYQTSDELLLKSILLLIEKCYRSDLKSVILTADADQQEMLNKNLWTYSRKQFIPHGSKLDPQPEKQPIYITDELQ 80 
238651118   1 MQQFSIYQTSDELLLKSILLLIEKCYHSDLKSVILTADADQQEMLNKNLWTYSRKQFIPHGSKLDPQPEKQPIYITDELQ 80 
15893269   81 NPNNASVLVIISPTDIGKILQAKEYIRVFKRIIIITDLPEDLKELTVKINKFTGQENKIDCFTQNPRGAWNKVV 154
161729084  81 NPNNASVLVIISPTDIAKILQVKEYIKVFKRIIIITDLLENLKELIIKINKFTGQENKIDCFTQNPIGTWNKIA 154
157829183  81 NPNNASVLVIISPTDIGKILQAKEYIRVFKRIIIITDLPEDLKELTVKINKFTEQENKIDCFTQNPRGAWNKVV 154
165933911  81 NPNNASVLVIISPTDIGKILQAKEYIRVFKRIIIITDLPEDLKELTVKINKFTEQENKIDCFTQNPRGAWNKVV 154
51474041   81 NPNNASVLIIISPTDIEKILQVKEYIRVFKRIIIITDLPEDLKQLIIKINKFTGQENKIDCFTQNPMGAWNKIA 154
157826359  81 NPNNASVLIIISPTAIEKILQIKDYVEVFKRIIIITDSPEDLKELTVKINKFTEQENKIDCFTQNLRGTWNKVE 154
157804263  81 NPNNASVLIIISPIDIGKILQVKDYIEVFKRIIIITHFLEDLKELTVKVNKFTEQENKIDCFKQDMRGAWNKVK 154
91206236   81 NPNNASVLIIISPTNIEKILQAKEYVSDFKRIIIITYLPEDLKKLNLKINQITKQENTIDCFTQDQRGSWNKI- 153
157827852  81 NPNNASVLIIISPTNIEKILQAKEYVSDFKRIIIITYLPEDLKKLNLKINQITKQENTIDCFTQDQRGSWNKI- 153
229587243  81 NPNNASVLVIISPTDIGKILQAKEYIRVFKRIIIITDLPEDLKELTVKINKFTGQENKIDCFTQNPRGAWNKVV 154
157965013  83 NPNNASVLVIISPTDIGKILQAKEYIRVFKRIIIITDLPEDLKELTVKINKFTGQENKIDCFTQNPRGAWSKVV 156
67459767   81 NPNNASVLVIISPTDIGKILQAKEYIRVFKRIIIITDLPEDLKELTAKINKFTEQENKIDCFTQNLRGTWNKVE 154
238651118  81 NPNNASVLVIISPTDIGKILQAKEYIRVFKRIIIITDLPEDLKELTVKINKFTGQENKIDCFTQNPRGAWNKVV 154
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap