Conserved Protein Domain Family
PRK06642

?
PRK06642: PRK06642 
single-stranded DNA-binding protein; Provisional
Statistics
?
PSSM-Id: 135984
View PSSM: PRK06642
Aligned: 13 rows
Threshold Bit Score: 279.683
Threshold Setting Gi: 91204976
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15893218    1 MAGSLNKVILIGNVGRDPEMRTTGEGKKIINLSLATTETWKDRITSERKERTEWHRVVIFSEGLVSVVERYVTKGSKLYI 80 
15604667    1 MAGSLNKVILIGNVGRDPEIRTTGEGKKIINLSLATTETWKDRITSERKERTEWHRVVIFSEGLVSIVERYVTKGSKLYI 80 
157829131   1 MAGSLNKVILIGNVGRDPEMRTTGEGKKIINLSLATTETWKDRITSERKERTEWHRVVIFSEGLVSVVERYVTKGSKLYI 80 
165933856   1 MAGSLNKVILIGNVGRDPEMRTTGEGKKIINLSLATTETWKDRITSERKERTEWHRVVIFSEGLVSVVERYVTKGSKLYI 80 
51474004    1 MAGSLNKVILIGNVGRDPEIRTTGEGKKIINLSLATTETWKDRITSERKERTEWHRVVIFSEGLVSIVERYVTKGSKLYI 80 
157826305   1 MAGSLNKVILIGNVGRDPEIRTTGEGKKIINLSLATTETWKDRITSERKERTEWHRVVIFSEGLVSVVERYVAKGSKLYI 80 
157804225   1 MAGSLNKVILIGNVGRDPEIRTTGEGKKIINLSLATTETWKDRVTGERKERTEWHRVVIFSEGLVSVVERYVTKGSKLYI 80 
91204976    1 MAGSLNKVTLIGNLGRDPEIRTTGEGKEIANLSLATTDIWKDRVTGEKKEKTEWHRVVIFNEGLVSVVKNYVKKGSKLYI 80 
157827694   1 MAGSLNKVTLIGNLGRDPEIRTTGEGKEIANLSLATTDIWKDRVTGEKKEKTEWHRVVIFNEGLVSVVKNYVKKGSKLYI 80 
229587202   1 MAGSLNKVILIGNVGRDPEMRTTGEGKKIINLSLATTETWKDRITSERKERTEWHRVVIFSEGLVSVVERYVTKGSKLYI 80 
157964985   1 MAGSLNKVILIGNVGRDPEVRTTGEGKKIINLSLATTETWKDRITSERKERTEWHRVVIFSDGLVSVVERYVTKGSKLYI 80 
67459717    1 MAGSLNKVILIGNVGRDPEIRTTGEGKKIINLSLATTETWKDRITSERKERTEWHRVVIFSEGLVSVVERYVTKGSKLYI 80 
238650832   1 MAGSLNKVILIGNVGRDPEMRTTGEGKKIINLSLATTETWKDRITSERKERTEWHRVVIFSEGLVSVVERYVTKGSKLYI 80 
15893218   81 EGSLQTRKWNDNSGQEKYTTEVVLQNFNSQLILLDSKNSNNHN-QDSGHSEYKHPETKNHSFDHSDLDDEIPF 152
15604667   81 EGSLQTRKWNDNSGQEKYTTEVVLQNFNSQLILLDHKNSNQNT-QGSGHHEYKYPETKNHSFDHSDLDDEIPF 152
157829131  81 EGSLQTRKWNDNSGQEKYTTEVVLQNFNSQLILLDSKNSNNHN-QDSGHSEYKHPEIKNHSFDHSDLDDEIPF 152
165933856  81 EGSLQTRKWNDNSGQEKYTTEVVLQNFNSQLILLDSKNSNNHN-QDSGHSEYKHPETKNHSFDHSDLDDEIPF 152
51474004   81 EGSLQTRKWNDNSGQEKYTTEVVLQNFNSQLILLDNKNSNNHT-QGSGHNEYKYPEIKNHSFDHSDLDDEIPF 152
157826305  81 EGSLQTRKWNDNSGQEKYTTEVVLQNFNSQLILLDSKNSNNHN-QDSGHSEYKHTETKNHSFDHSDLDDEIPF 152
157804225  81 EGSLQTRKWNDNSGQEKYTTEVVLQNFNAQLILLDSKNSNNHT-QDSGHNEYKYPETKNHSFDHSDLDDEIPF 152
91204976   81 EGSLQTRKWNDSSGVEKYTTEIVLQNFNSQLILLDSKNSTSSSlQDSGHSEYKHSKP---SFDHSDLDDEIPF 150
157827694  81 EGSLQTRKWNDSSGVEKYTTEIVLQNFNSQLILLDSKNSTSSSlQDSGHSEYKHSKP---SFDHSDLDDEIPF 150
229587202  81 EGSLQTRKWNDNSGQEKYTTEVVLQNFNSQLILLDSKNSNNHN-QDSGHSEYKHPETKNHSFDHSDLDDEIPF 152
157964985  81 EGSLQTRKWNDNSGQEKYTTEVVLQNFNSQLILLDSKNSNNHT-QDSGHSEYKHPETKNHSFDHSDLDDEIPF 152
67459717   81 EGSLQTRKWNDNSGQEKYTTEVVLQNFNSQLILLDSKNSNNHT-QDSGRSEYKHPEAKNHSFDHSDLDDEIPF 152
238650832  81 EGSLQTRKWNDNSGQEKYTTEVVLQNFNSQLILLDSKNSNNHN-QDSGHSEYKHPETKNHSFDHSDLDDEIPF 152
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap