Conserved Protein Domain Family
PRK06630

?
PRK06630: PRK06630 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 168631
View PSSM: PRK06630
Aligned: 13 rows
Threshold Bit Score: 162.058
Threshold Setting Gi: 91205182
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15604562    1 MSWIDKFFITFFYTKVGEDEFLNQYYESRnNIDYLGRSRRCVIYKNINESTKIPPSWYSWLHHLVNEIPKNVQLFPWQQN 80 
15893030    1 MSWIDKCFITFFHKKVGEDEFLNQYYESR-NIDYLGRPRRFVIYKNVNEPTKIPPSWHAWLHHLVNERPKSIQLFPWQKN 79 
157828952   1 MSWIDKCFITFFHKKVGEDEFLNQYYESR-NIDYLGRPRRFVIYKNVNEPTKIPPSWHAWLHHLVNEIPKNIQLFPWQKN 79 
165933677   1 MSWIDKCFITFFHKKVGEDEFLNQYYESR-NIDYLGRPRRFVIYKNVNEPTKIPPSWHAWLHHLVNEIPKNIQLFPWQKN 79 
51473896    1 MSWIDKFFITFFYTKVGEDEFLNQYYESKnNIDYLGRSRRCVIYKNINESTKIPPSWYAWLHHLVNEIPKNVQLFPWQQN 80 
157826200   1 MSWIDKFFITFFHKKVGEDEFLNQYYESR-NIDYLGRSRRFVIYKNVNEPTTIPPSWHTWLHHLVDEIPKNIQLFPWQKN 79 
157803407   1 MSCIDKFFITFFHKKVGEDEFLNQYYESR-NIDYLGRPRRFVIYNNVNEPTKIAPSWHVWLHHLVNEIPKNIQLFPWQDN 79 
91205182    1 MSWINKFFITFFHKKVGEDELLNQYYESK-KLDYLGRPKRFVIYKNANEPTKISPSWHAWLHHLVNEVPKNIKLFSWQES 79 
157827482   1 MSWINKFFITFFHKKVGEDELLNQYYESK-KLDYLGRPKRFVIYKNANEPTKISPSWHAWLHHLVNEVPKNIKLFSWQES 79 
229587081   1 MSWIDKCFITFFHKKVGEDEFLNQYYESR-NIGYLGRPRRFVIYKNVNEPTKIPPSWHAWLHHLVNEIPKNIQLFPWQKN 79 
157964868   1 MSWIDKLFITFFHKKVGEDEFLNQYYESR-NIDYLGRPRRFVIYKNVNEPTKIPPSWHAWLHHLVNEIPKNIQLLPWQKN 79 
67458573    1 MSWIDKFFITFFHKKVGEDEFLNQYYESR-NIDYLGRPRRFVIYKNVNEPTKIPPSWHAWLHHLVNEIPKNIQLFPWQKN 79 
238650383   1 MSWIDKYFITFFHKKVGEDEFLNQYYESR-NIDYLGRPRRFVIYKNVNEPTKILPSWHAWLHHLVNEIPKNIQLFPWQKN 79 
15604562   81 ------------------------------------------------NKITKKLPKTSNLKYNRWQP 100
15893030   80 ------------------------------------------------NKMVKKLPKTSNLKYNRWQP 99 
157828952  80 ------------------------------------------------NKIVKKLPKTSNLKYNRWQP 99 
165933677  80 ------------------------------------------------NKIVKKLPKTSNLKYNRWQP 99 
51473896   81 ------------------------------------------------KKIVKKLPKTSNLKYNRWQP 100
157826200  80 ------------------------------------------------DKIVQKPPKTSNLKYSRWQP 99 
157803407  80 thlakftyreefkgdtecstaayiniredastgstyklplevecakmsNKIAKKPPKTSYLKYNRWQP 147
91205182   80 ------------------------------------------------NKISQKSSKSSNARYSRWQP 99 
157827482  80 ------------------------------------------------NKISQKSSKSSNARYSRWQP 99 
229587081  80 ------------------------------------------------NKIVKKLPKTSNLKYNRWQP 99 
157964868  80 ------------------------------------------------NKIVKELSKTSNLKYNRWQP 99 
67458573   80 ------------------------------------------------NKIVKKPPKTSNLKYSRWQP 99 
238650383  80 ------------------------------------------------NKIVKKLPKTSNLKYNRWQP 99 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap