Conserved Protein Domain Family
PRK06628

?
PRK06628: PRK06628 
lipid A biosynthesis lauroyl acyltransferase; Provisional
Statistics
?
PSSM-Id: 102471
View PSSM: PRK06628
Aligned: 13 rows
Threshold Bit Score: 565.711
Threshold Setting Gi: 51473888
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15893014    1 MKKFLKKLRYLIEYFIVVIFLKVIGIFGVDKAADICSFIARKVGILFAVNKIARRNIKVVFGDMCDVEKIIDQTWDNFGR 80 
15604555    1 MKKFLKKLRYLIEYFIVIIFLKVIGIFGIDKASDICSFIARKVGILFAVNKIAKRNIKAVFGDMYDVEKIIDQTWDNFGR 80 
157828939   1 MKKFLKKLRYLIEYFIVVIFLKVIGIFGVDKAADICSFIARKVGILFAVNKIARRNIKVVFGYMCDVEKIIDQTWDNFGR 80 
165933663   1 MKKFLKKLRYLIEYFIVVIFLKVIGIFGVDKAADICSFIARKVGILFAVNKIARRNIKVVFGYMCDVEKIIDQTWDNFGR 80 
51473888    1 MKKFLKKLRYLIEYFIVIIFLKVIGIFGIDKASDICSFIARKVGILFAVNKIAKRNIKAVFGDMYDVEKIIDQTWDNFGR 80 
157826137   1 MKKFLKKLRYLIEYFIVVIFLKVIGIFGVDKAADICSFIARKVGILFAVNKIAKRNIKAVFGDMCDVEKIIDKTWDNFGR 80 
157804099   1 MKKFLKKLRYLIEYFIIVIFLKVIGMLGMDKAADICSFIARKIGILFAVNKIARSNIKAVFGDMCDVEKIIDQTWGNFGR 80 
91205001    1 MKKFLKKIRYLIEYAIVIIFLKIIGIFGIDKAADICSFIARKIGILFAVNKIARRNVKAVFGDAFDVEKTIDQTWDNFGR 80 
157827667   1 MKKFLKKIRYLIEYAIVIIFLKIIGIFGIDKAADICSFIARKIGILFAVNKIARRNVKAVFGDAFDVEKTIDQTWDNFGR 80 
229587070   1 MKKFLKKLRYLIEYFIVVIFLKVIGIFGVDKAADICSFIARKVGTLFAVNKIARRNIKVVFGDMCDVETIIDQTWDNFGR 80 
157964861   1 MKKFLKKLRYLIEYFIVVILLKVIGIFGVDKAADICSFIARKVGILFAVNKIARRNIKVVFGDMCDVEKIIDQTWDNFGR 80 
67458589    1 MKKFLKKLRYLIEYFIVVIFLKVIGIFGVDKAADICSFIARKVGILFAVNKIARRNIKAVFGDMCDVEKIIDQTWDNFGR 80 
238650374   1 MKKFLKKLRYLIEYFIVVIFLKVIGIFGVDKAADICSFIARKVGILFAVNKIARRNIKVVFGDMCDVEKIIDQTWDNFGR 80 
15893014   81 FIGEFTYVSKMDEAELERRIAIIGIENIKKLEGQPFLLFGGHFANWDISIKILHKFYPKVAVIYRKANNPYVNKLVNESR 160
15604555   81 FIGEFIYVDKMDESELESRIEIIGKENIKKLEDQPFLLFSGHFANWDISLKVLKKYYPKVAVIYRKANNPYVNKLVNESR 160
157828939  81 FIGEFTYVSKMDEAELERRIAIIGIENIKKLEGQPFLLFSGHFANWDISIKILHKFYPKVAVIYRKANNPYVNKLVNESR 160
165933663  81 FIGEFTYVSKMDEAELERRIAIIGIENIKKLEGQPFLLFSGHFANWDISIKILHKFYPKVAVIYRKANNPYVNKLVNESR 160
51473888   81 FIGEFTYVDKMDESELERRIEIIGKENIQKLEDQPFLLFSGHFANWDISLKVLKKYYPKVAVIYRKANNPYVNKLVNESR 160
157826137  81 FIGESAYVNKMSDAELEHRAEIIGIENIRKLGERPFLLFSGHFANWDIGLHLLHKSYSKFAVIYRKANNPYVNKLINESR 160
157804099  81 FIGEFAYVNKMNEVELKRRIEIIGIENIKKLEGQPFLLFSGHFANWDIALKRLYKSYPKFAVIYRKANNPYVNKLVNESR 160
91205001   81 FVGEFAYINEMDELELERRIEIIGLENIKKLKGQPFLFFTGHFANWDIAVKIIHKIYPKFAVIYRKANNPYVNKLINESR 160
157827667  81 FVGEFAYINEMDELELERRIEIIGLENIKKLKGQPFLFFTGHFANWDIAVKIIHKIYPKFAVIYRKANNPYVNKLINESR 160
229587070  81 FIGEFTYVSKMDEAELERRITIIGIENIKKLEGQPFLLFGGHFANWDISIKILHKFYPKVAVIYRKANNPYVNKLVNESR 160
157964861  81 FIGEFTYVGKMDEAELERRIEIIGIENIKKLAGQPFLLFSGHFANWDISLKLLHKFYPKVAVIYRKANNPYVNKLVNESR 160
67458589   81 FIGESAYVNKMSEAELENRAEIIGIENIKKLGEQPFLLFSGHFANWDIGLNLLHKSYPKFAVIYRKANNPYVNKLINESR 160
238650374  81 FIGEFTYVSKMDEAELERRIAIIGIENIKKLEGQPFLLFSGHFANWDISIKILHKFYPKVAVIYRKANNPYVNKLVNESR 160
15893014  161 AGDKLRLIPKGPEGSRALVRAIKESESIVMLVDQKMNDGIEVPFLGHPAMTASAIAKIALQYKYPIIPCQIIRTKGSYFK 240
15604555  161 AGDKLRLIPKGSEGIRSLVRAIKEGESIVMLVDQKMNDGIEVPFLGRPSMTASSIAKIALQYKYPIIPCQIIRTKGSYFK 240
157828939 161 AGDKLRLIPKGPEGSRALVRAIKESEAIVMLVDQKMNDGIEVPFLGHPAMTASAIAKIALQYKYPIIPCQIIRTKGSYFK 240
165933663 161 AGDKLRLIPKGPEGSRALVRAIKESEAIVMLVDQKMNDGIEVPFLGHPAMTASAIAKIALQYKYPIIPCQIIRTKGSYFK 240
51473888  161 AGDKLRLIPKGSEGIRALVSAIKEGESIVMLVDQKMNDGIEVPFLGRPSMTASAIAKIALQYKYPIIPCQIIRTKGSYFK 240
157826137 161 AGDKLRLIPKGPEGRRALVRAIKDGESIVMLVDQKMNDGIEVPFLGHPAMTANAIAKIALQYKYTIIPCQIIRTKGSYFK 240
157804099 161 ASDKLRLIPKGPEGSRALFRAIKEGESIVMLVDQKMNNGIEVPFLGYPAMTANAIAKIALQYKYPIIPCQIIRTKGSYFK 240
91205001  161 ASSKLRLIPKGPDGSRALVRAIKGRESIAMLVDQKMNDGIEVPFLGYPAMTANAIAKIALQYGYPIVPCQIVRTKGSYFK 240
157827667 161 ASSKLRLIPKGPDGSRALVRAIKGRESIAMLVDQKMNDGIEVPFLGYPAMTANAIAKIALQYGYPIVPCQIVRTKGSYFK 240
229587070 161 AGDKLRLIPKGPEGSRALVRAIKESESIVMLVDQKMNDGIEVPFLGHPAMTASAIAKIALQYKYPIIPCQIIRTKGSYFK 240
157964861 161 ASDKLRLIPKGPEGSRALVRAIKESASIVMLVDQKMNDGIEVPFLGHPAMTASAIAKIALQYKYPIIPCQIIRTKGSYFK 240
67458589  161 TSDKLRLIPKGPDGSRALVRAIKESESIVMLVDQKMNDGIEVPFLGHPAMTANAIAKIALQYKYPIIPCQIIRTKGSYFK 240
238650374 161 AGDKLRLIPKGSEGSRALVRAIKESESIVMLVDQKMNDGIEVPFLGHPAMTASAIAKIALQYKYPIIPCQIIRTKGSYFK 240
15893014  241 VIVHPQLKFEQTGDNKADCYNIMLNINQMLGEWVKQNPAQWFWFHNRWKK 290
15604555  241 VIVHPQLKFEQTGDNKVDCYNIMFNINQILGEWVKQNPAQWFWFHNRWKK 290
157828939 241 VIVHPQLKLEQTGDNKADCYNIMLNINQMLGEWVKQNPAQWFWFHNRWKQ 290
165933663 241 VIVHPQLKLEQTGDNKADCYNIMLNINQMLGEWVKQNPAQWFWFHNRWKQ 290
51473888  241 VIVHPQLKFEQTGDNKVDCYNIMFYINQILGEWVKQNPAQWFWFHNRWKK 290
157826137 241 VIVHPQLEFEQTGDNKADCYNIMLNINQMLGEWVKQNPSQWFWFHNRWKK 290
157804099 241 LILHSQLMFEQSGDNKVDCYNIMLNINQILGEWVKQNPSQWFWFHNRWKK 290
91205001  241 LIIHPNLTWEQTGDSKTDCYNIMLNINQILGDWVKQNPSQWFWFHNRWKK 290
157827667 241 LIIHPNLTWEQTGDSKTDCYNIMLNINQILGDWVKQNPSQWFWFHNRWKK 290
229587070 241 VIVHPQLKFEQTGDNKADCYNIMLNINQMLGEWVKQNPAQWFWFHNRWKK 290
157964861 241 VIVHPQLKFEQTGDNKADCYNIMLNINQMLGEWVKQNPSQWFWFHNRWKK 290
67458589  241 VIVHPQLKFEQTGDNKADCYNIMLNINQMLGEWVKQNPSQWFWFHNRWKK 290
238650374 241 VIVHPQLKLEQTGDNKADCYNIMLNINQMLGEWVKQNPAQWFWFHNRWKK 290
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap