Conserved Protein Domain Family
PRK06620

?
PRK06620: PRK06620 
hypothetical protein; Validated
Statistics
?
PSSM-Id: 168630
View PSSM: PRK06620
Aligned: 15 rows
Threshold Bit Score: 331.807
Threshold Setting Gi: 148284485
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
189184534   1 MQHTINFPNNSKYLEEDYIVTSSNFDAYQLIKNWPSMWGITPYSKSLLVCGPPSSGKTYLANIWQRYANAVFMSSSDNID 80 
51473811    2 QQYIFRFTTSNKYHPDEFIVSSSNAQAYNIIKNWQCCFGVNPYKFTLLIKGPSSSGKTYLTKIWQNLSNAYIIKDIFLNE 81 
157826035   2 QQYIFRFTTSNKYHHDEFIVSSSNEQAYNIVKNWQYSFGVNPYKFTVLIKGPSSSGKTYLTKIWQNLSNAYIIKDSFFNA 81 
157803499   2 QQYIFRFTTPNKYHPDEFIVSSSNDQAYNIIQNWQHRFGVNPYKFTLLIKGPSSSGKTYLTKIWQNLSNAYIIKDIFFNE 81 
91205351    1 MQYIFPFNNSSKYHPEEFIVSESNALVYNALQNWQNSFGVNPYKLTLLIKGPASSGKTYLTKIWQNLSNAYIIKDIFFDD 80 
229586980   2 QQYIFRFTTSSKYHPDEFIVSSSNDQAYNIIKNWQCGFGVNPYKFTLLIKGPSSSGKTYLTKIWQNLSNAYIIKDIFFNE 81 
67458792    2 QQYIFRFITSNKYHPDEFIVSSSNEQAYNIIKNWQCNFGVNPYKFTLLIKGPSSSGKTYLTKIWQNLSNAYIIKDIFFNE 81 
238651086   2 QQYIFRFTTSSKYHPDEFIVSSSNDQAYNIIKNWQCGFGVNPYKFTLLIKGPSSSGKTYLTKIWQNLSNAYIIKDIFFNE 81 
15892902    2 QQYIFRFTTSSKYHPDEFIVSSSNDQAYNIIKNWQCGFGVNPYKFTLLIKGPSSSGKTYLTKIWQNLSNAYIIKDIFFNE 81 
15604478    2 QQYIFHFTPSNKYHPDEFIVSSSNAQAYNIIKNWQYCFGANPYKFTLLIKGPSSSGKTYLTKIWQNLSNAYLIKDIFFNE 81 
189184534  81 QFYQTKPSFIIEDIDktHWTDKKLLHIFNILHENNKFLMLTCSMHPTNFILPDLASRLSAVLTIKLHRPDDEMMKIVLMK 160
51473811   82 EILEKNNTFIIEDIE--SWQEPALLHIFNIINEKQKYLLLTSSDKNDNFTLPDLSSRIKSVLSILLNSPDDELIKILIFK 159
157826035  82 EILEKYNACIIEDIE--NWQEPALLHIFNIINEKQKYLLLTSSDKTRNFTLPDLSSRIKSVLSIALNSPDDELIKILIFK 159
157803499  82 EILEQYNAFIIEDIE--NWQEPALLYIFNIINEKRKYLLLTSFDKSKNFALPDLSSRIKSVLSIVLNSPDDELIKVLIFK 159
91205351   81 KILANHTAFIIEDIE--NWQETALLHLFNLINEKQKYLLLTSNNKGKNFTLPDLSSRINSILNVLLYPPDDELIKILIFK 158
229586980  82 EISEKYNAFIIEDIE--NWQEPTLLHIFNIINEKQKYLLLTASDKSRNFTLPDLSSRIKSVLSILLNSPDDELIKILIFK 159
67458792   82 EILEKYNAFIIENIE--NWQEPALLHIFNIINEKQKYLLLTSSNKSRNFTLPDLSSRIKSVLSIALNSPDDELIKILIFK 159
238651086  82 EISEKYNAFIIEDIE--NWQEPTLLHIFNIINEKQKYLLLTASDKSRNFTLPDLSSRIKSVLSILLNSPDDELIKILIFK 159
15892902   82 EISEKYNAFIIEDIE--NWQEPTLLHIFNIINEKQKYLLLTASDKSRNFTLPDLSSRIKSVLSILLNSPDDELIKILIFK 159
15604478   82 EILEKYNTFIIEDIE--NWQEPTLLHIFNVINEKQKYLLLTSSDKNNNFTLPDLSSRIKSVLSILLNAPDDELIKILIFK 159
189184534 161 AFSERSLKVSTEIINYLSSRLTREFSIIHDTVKLIDKYSLEHKRNITIPLLKELLK 216
51473811  160 HFSISSVTISRQIIDLLLVNLPREYSKIIEILENINYFALISKRKITISLVKEVLN 215
157826035 160 HFSISSVTISGQIIDFLLVNLPREYSKIIEILENINHSALISKRKITTSLVKEVLN 215
157803499 160 HFSISSVIISRQIIDFLLVNLPREHSKIIEILENINQIALTSKRKITTSLVKEVLN 215
91205351  159 HFATSSVTISQIVIDFLLVNLPREYNRILEILEYINNFALTSKRKITIPLVKEALS 214
229586980 160 HFAISSVTISRQIIDFLLVNLPREYSKIIEILDNINYFALISKRKITTSLVKEVLN 215
67458792  160 HFSISSVTISGQIIDFLLVNLPREYSKIIEILENINYFALISKRKITTSLVKEVLN 215
238651086 160 HFAISSVTISRQIIDFLLVNLPREYSKIIEILDNINYFALIAKRKITTSLVKEVLN 215
15892902  160 HFAISSVTISRQIIDFLLVNLPREYSKIIEILDNINYFALISKRKITTSLVKEVLN 215
15604478  160 HFSISSVTISQQIIDFLLVNLPREYSKIIEILENINYFALISKRKITISLVKEVLN 215
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap