Conserved Protein Domain Family
PRK06617

?
PRK06617: PRK06617 
2-octaprenyl-6-methoxyphenyl hydroxylase; Validated
Statistics
?
PSSM-Id: 168629
View PSSM: PRK06617
Aligned: 12 rows
Threshold Bit Score: 684.731
Threshold Setting Gi: 157827202
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
51473741   10 MLNIVILGCGLSGMLTALSFAQKGIKTTILESKLVKSPDFLKDIRTTALTPYSKKFLFSIEIWKELEQFVAEMQDVYVVD 89 
15892771   58 MSNTVILGCGLSGMLTALSFAQKGIKTTIFESKSVKSPEFFKDIRTTALTPHSKNFLFSIDIWEELEKFVAEMQDIYVVD 137
157828707  55 MSNTVILGCGLSGMLTALSFAQKGIKTTIFESKSVKSPEFFKDIRTTALTPHSKNFLFSIDIWEELEKFVAEMQDIYVVD 134
165933431   1 MSNTVILGCGLSGMLTALSFAQKGIKTTIFESKSVKSPEFFKDIRTTALTPHSKNFLFSIDIWEELEKFVAEMQDIYVVD 80 
157825930   5 qidTIILGCGLSGMLTALSFAEKGIKTTIFESQSVKSPEFFNDIRITALTPHSKNFLFSIDIWAELEKFVAKMQEIYVVD 84 
157803605   1 MTNIVILGCGLSGMLTALSFAKKGIETTIFESKSVKSPEFFKDIRTTALTPHAKNFLSSIDIWEELEECTVGMQDVYVVD 80 
91205440   10 qidKVILGCGLSGMLTALAFAKNGIKTTIFESKSVKSPGFFNDIRTTALTPYSKDFLSSIDMWQELEEFVSHMKDVYVVD 89 
157827202   8 qidKVILGCGLSGMLTALAFAKNGIKTTIFESKSVKSPGFFNDIRTTALTPYSKDFLSSIDMWQELEEFVSHMKDVYVVD 87 
229586892  58 MSNTVILGCGLSGMLTALSFAQKGIKTTIFESKSVKSPEFFKDIRTTALTPHSKNFLFSIDIWEELEKFVAEMQDIYVVD 137
157964697  58 MSNTVILGCGLSGMLTALSFAQKGIKTTIFESKSVKSPEFFKDIRTTALTPHSKNFLFSIDIWEELEKCVAEMQDIYVVD 137
67459285    8 qidIIILGCGLSGMLTALSFAQKGIKTTIFESKSVKSPEFFKDIRTTALTPYSKNFLFSIGIWEELEKFVAKMQDVYVVD 87 
238650675  55 MSNTVILGCGLSGMLTALSFAQKGIKTTIFESKSVKSPEFFKDIRTTALTPHSKNFLFSIDIWEKFEKFVAEMQDIYVVD 134
51473741   90 NKASEMLDLRNENDAVLGYVIKNSDFKKILLSAITNNSFITLIDNNQYQEVISHNNYSIIKFNNDkQIKCDLLIICDGAN 169
15892771  138 NQASEILDLRNDADAVLGYVVKNSDFKKMLLSKITNNPLITLIDNNQYQEVISHNDYSIIKFDDN-QIKCNLLIICDGAN 216
157828707 135 NKASEILDLRNDADAVLGYVVKNSDFKKMLLSKITNNPLITLIDNNQYQEVISHNDYSIIKFDDN-QIKCNLLIICDGAN 213
165933431  81 NKASEILDLRNDADAVLGYVVKNSDFKKMLLSKITNNPLITLIDNNQYQEVISHNDYSIIKFDDN-QIKCNLLIICDGAN 159
157825930  85 NKAAEILDLRNDDDSVLGYVIKNSDFKKILLSRMTNNPWITLIDHNQYQDVISHNDYSIIKFDDK-HIKCSLLIICDGAN 163
157803605  81 NKASEILDLRNDNNNLLGYVVKNSDFKKILLSKITNHPLVTLIDNYKYQEVISHHNYSVIKFDNE-QIKCNLLIICDGAN 159
91205440   90 NKAPEILELKNDSS--LGYVVQNNDFKKILLSKIINNPLITLVDNKEYQEVISHDEHSIIKFDDKtYVKCNLLIVCDGAN 167
157827202  88 NKAPEILELKNDSS--LGYVVQNNDFKKILLSKIINNPLITLVDNKEYQEVISHDEHSIIKFDDKtYVKCNLLIVCDGAN 165
229586892 138 NQASEILDLRNDADAVLGYVVKNSDFKKMLLSKVTNNPLITLIDNNQYQEVISHNDYSIIKFDDN-QIKCNLLIICDGAN 216
157964697 138 NKASEILDLRNDVDAVLGYVVKNSDFKKVLLSKITNNPLITLIDNNQCQEVISHNDYSIIKFDDK-QIKCNLLIICDGAN 216
67459285   88 NKASEILDLRNDDDAVLGYVAKNSDFKKILLSKIANNPLITLIDNKQYQEVISHNGYSIIKFNDK-QIKCSLLIICDGAN 166
238650675 135 NKASEILDLRNDADAVLGYVVKNSDFKKMLLSKITNNPLITLIDNNQYQEVISHNDYSIIKFDDN-QIKCNLLIICDGAN 213
51473741  170 SKVRSYYFTNEVDKPYQTALTFNVKHEKPHENCAMEHFLPLGPFALLPLKDQYSSSVIWSTSSVQADLIINFPIKEVDFL 249
15892771  217 SKVRSHYFANEIEKPYQTALTFNIKHEKPHENCAMEHFLPFGPFALLPLKDQYASSVIWSTSSDQAALIVNLPVEEVRFL 296
157828707 214 SKVRSHYFANEIEKPYQTALTFNIKHEKPHENCAMEHFLPLGPFALLPLKDQYASSVIWSTSSDQAALIVNLPLEEVRFL 293
165933431 160 SKVRSHYFANEIEKPYQTALTFNIKHEKPHENCAMEHFLPLGPFALLPLKDQYASSVIWSTSSDQAALIVNLPLEEVRFL 239
157825930 164 SKVKSHYFANEIEKSYQTALTFNIKHENPHENCAMEHFLPLGPFALLPLKNQYASSVIWSTSSDQAALIVNLPVEEVRFL 243
157803605 160 SKARSHYFANKIEKPYQTALTFNIKHEKPHENSAMEHFLPLGPFALLPLKDQYASSVIWSTSSDQAALIMNLPVEEVRFL 239
91205440  168 SKVRSHYFANEIEKPYQTALVFNIKHEKPHENCAMEHFLPLGPFALLPMKDQHSSSVIWSTSSDQAALIMQLPIEEVRFL 247
157827202 166 SKVRSHYFANEIEKPYQTALVFNIKHEKPHENCAMEHFLPLGPFALLPMKDQHSSSVIWSTSSDQAALIMQLPIEEVRFL 245
229586892 217 SKVRSHYFANEIEKPYQTALTFNIKHEKPHENCAMEHFLPLGPFALLPLKDQYASSVIWSTSSDQAALIVNLPVEEVRFL 296
157964697 217 SKVRSHYFANEIEKPYQTALTFNIKHEKPHENCAMEHFLPLGPFALLPLKDQYASSVIWSTSSDQAVLIVNLPVEEVRFL 296
67459285  167 SKVRSHYFANEIEKPYQTALTFNIKHKNPHENCAMEHFLPLGPFALLPLKNQYASSVIWSTSSDQAALIVNLPVEEVRFL 246
238650675 214 SKVRSHYFANEIEKPYQTALTFNIKHEKPHENCAMEHFLPLGPFALLPLKDQYASSVIWSTSSDQAALIVNLPVEEVRFL 293
51473741  250 IQRNAGHFLGQITIDSEISSFPLKAFIANRYFHNRIVLIADTAHIIHPLAGQGLNQGIKDIEILSMIIS-NNGTLQEYQK 328
15892771  297 TQRNAGNSLGKITIDSEISSFPLKARIANRYFHNRIVLIADTAHTVHPLAGQGLNQGIKDIEILSMIVS-NNGPLQEYQK 375
157828707 294 TQRNAGNSLGKITIDSEISSFPLKARIANRYFHNRIVLIADTAHTVHPLAGQGLNQGIKDIEILSMIVS-NNGTLQEYQK 372
165933431 240 TQRNAGNSLGKITIDSEISSFPLKARIANRYFHNRIVLIADTAHTVHPLAGQGLNQGIKDIEILSMIVS-NNGTLQEYQK 318
157825930 244 TQRNAGNSLGKITIDSEISSFPLKARIANRYFHNKIVLIADTAHTIHPLAGQGLNQGIKDIETLSMIVS-NNGTLQEYQK 322
157803605 240 TQRNAGNALGKITIDSEMSSFPLKARMVNRYFHNKIVLIADTAHIIHPLAGQGLNQGIKDIETLSMVISnNNGSLERYQK 319
91205440  248 TQRNAGNSLGKITIDSEVNGFPLKARIANRYFHNKIVLIADSAHVVHPLAGQGLNQGIKDIESLISVVS-NNLLLSEYQK 326
157827202 246 TQRNAGNSLGKITIDREVNGFPLKARIANRYFHNKIVLIADSAHVVHPLAGQGLNQGIKDIESLISVVS-NNLLLSEYQK 324
229586892 297 TQRNTGNSLGKITIDSEISSFPLKARIANRYFHNRIVLIADTAHTVHPLAGQGLNQGIKDIEILSMIVS-NNGTLQEYQK 375
157964697 297 TQRNAGNSLGKITIDSEISSFPLKARIANRYFHNRIVLIADTAHTVHPLAGQGLNQGIKDIEILSMIVS-NNGTLQEYQK 375
67459285  247 TQRNAGNSLGKITIDSEISSFPLKARIANRYFHNKIVLIADTAHTVHPLAGQGLNQGIKDIEVLSMIVS-NNGTLQEYQK 325
238650675 294 TQRNAGNSLGKITIDSEISSFPLKARIANRYFHNRIVLIADTAHTVHPLAGQGLNQGIKDIEILSMIVS-NNGTLQEYQK 372
51473741  329 LRQYDNFIMYKLTDSLNSIFSSYSINLRCLRQIGFKVINNLKPIKNLITNYAMGQR 384
15892771  376 LRQEDNFIMYKLTDELNNIFSNHSKNLRCLRQIGFKVINNFKPVKNLITSYAMGKR 431
157828707 373 LRQEDNCIMYKLTDELNNMFSNYSKNLRCLRQIGFKVINNFKPVKNLITSYAMGKR 428
165933431 319 LRQEDNCIMYKLTDELNNMFSNYSKNLRCLRQIGFKVINNFKPVKNLITSYAMGKR 374
157825930 323 LRQEDNFIMYKLTDELNNIFSNYAKNVRYLRQIGFKAINNFKPIKTLITGYAMGKR 378
157803605 320 LRQDDNFIMYKLTDELNNIFSHYSKNLRFIRQIGFKAINNFKPIKNLIMNYAMGER 375
91205440  327 SRQTDNFIMYKLTDELNNIFSNHSKSLRHLRQIGFKAINNFKPIKNLITSYAMGKR 382
157827202 325 SRQTDNFIMYKLTDELNNIFSNHSKSLRHLRQIGFKAINNFKSIKNLITSYAMGKR 380
229586892 376 LRQEDNFIMYKLTDELNNIFSNYSKNLRCLRQIGFKVINNFKPVKNLITSYAMGKR 431
157964697 376 LRQEDNFIMYKLTDELNNIFSNYSKNLRCLRQIGFKVINNFKPVKNLITSYAMGKR 431
67459285  326 LRQEDNFIMYKLTDELNNIFSNYSKNLRCLRQIGFKAINNFKPIKNLITSYAMGRR 381
238650675 373 LRQEDNFIMYKLTDELNNIFANYSKNLRCLRQIGFKVINNFKSVKNLVTSYAMGKR 428
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap