Conserved Protein Domain Family
PRK06603

?
PRK06603: PRK06603 
enoyl-[acyl-carrier-protein] reductase FabI
Statistics
?
PSSM-Id: 168626
View PSSM: PRK06603
Aligned: 13 rows
Threshold Bit Score: 511.09
Threshold Setting Gi: 229586630
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15892417    1 MTTGLLQGKKGLITGIANNMSISWAIAQLAKKHGAELWFTYQSGVLEKRVKPLAKEIGCNFVSELDVTKPKSISNLFDDI 80 
15604232    1 MTTGLLQGKKGLITGIANNMSISWAIAQLAKKHGAELWFTYQSEVLEKRVKPLAEEIGCNFISELDVTNQKSISNLFNDI 80 
157828365   1 MTTGLLQGKKGLITGIANNMSISWAIAQLAKKHGAELWFTYQSGVLEKRVKPLAEEIGCNFVSELDVTKPKSISNLFDDI 80 
165933073   1 MTTGLLQGKKGLITGIANNMSISWAIAQLAKKHGAELWFTYQSGVLEKRVKPLAEEIGCNFVSELDVTKPKSISNLFDDI 80 
51473557    1 MTTRLLQGKKGLITGIANNMSISWAIAQLAKKHGAELWFTYQSEALEKRVKPLAEEIGCNFISELDVTDQKSISNLFNDI 80 
157825627   1 MTTGLLQGKKGLITGIANNMSISWAIAQLTKKHGAELWFTYQSEVLEKRVKPLAEEIGCNFVSELDVTNPKSISNLFDDI 80 
157803894   1 MTTGLLHGKKGLITGIANNMSISWAIAQLAKKHEAELWFTYQSEVLEKRVKPLAEEIGCNFVSKLDVTNPKSISNLFDDI 80 
91206070    1 MTTGLLQGKRGIITGIANNMSISWAIAQLARKHGAELCFTYQSEILEKRVKPLAEEVGCNFVSELDVTNPESITNLFAEV 80 
157826574   1 MTTGLLQGKRGIITGIANNMSISWAIAQLARKHGAELCFTYQSEILEKRVKPLAEEVGCNFVSELDVTNPESITNLFAEV 80 
229586630   1 --MQIICQYRG-------------AIAQLAKKHGAELWFTYQSGVLEKRVKPLAEEIGCNFVSELDVTKPKSISNLFDDI 65 
157964443   1 MTTGLLQGKKGLITGIANNMSISWAIAQLAKKHGAELWFTYQSEVLEKRVKPLAEEIGCNFVSELDVTNPKSISNLFDDI 80 
67458967    1 MTTGLLQGKKGLITGIANNMSISWAIAQLAKKHGAELWFTYQSEVLEKRVKPLAEEIGCNFVSELDVTNPKSISNLFDDI 80 
238651029   1 MTTGLLQGKKGLITGIANNMSISWTIAQLAKKHGAELWFTYQSGVLEKRVKPLAEEIGCNFVSELDVTKPKSISNLFDDI 80 
15892417   81 KEKWGSFDFLLHGMAFADKNELKGRYVDTSLENFHNSLHISCYSLLELSRSAEALMHNGGSIVTLTYYGAEKVIPNYNVM 160
15604232   81 KEKWNSFDFLLHGMAFANKNELKGRYVETSLENFHNSLHISCYSLLELSRSAETLMHNGGSIVTLTYYGAEKVIPNYNIM 160
157828365  81 QEKWGSFDFLLHGMAFADKNELKGRYVDTSLENFHNSLHISCYSLLELSRSAEALMHNGGSIVTLTYYGAEKVIPNYNVM 160
165933073  81 QEKWGSFDFLLHGMAFADKNELKGRYVDTSLENFHNSLHISCYSLLELSRSAEALMHNGGSIVTLTYYGAEKVIPNYNVM 160
51473557   81 KEKWNSFDFLLHGMAFANKNELKGRYVDTSLENFYNSLHISCYSLLELSRSAETLMHDGGSILTLTYYGAEKVIPNYNIM 160
157825627  81 KAKWYSFDFLLHGMAFADKNELKGRYVDTSLENFHNSLHISCYSLLELSRSAEALMHDGGSIVTLTYYGAEKVIPNYNVM 160
157803894  81 KEKWGSFDFLLHGMAFADKNALNGRYVDTSLENFHNSLHISCYSLLELSRAAEPLMDDGGSIVTLTYYGAEKVIPNYNIM 160
91206070   81 KEKWGTFDFLLHGMAFSDRNELKGRYIDTSLGNFNNSLHISCYSLVELAREAEKLMNDGGSIVTLSYYGAEKVIPNYNVM 160
157826574  81 KEKWGTFDFLLHGMAFSDRNELKGRYIDTSLGNFNNSLHISCYSLVELAREAEKLMNDGGSIVTLSYYGAEKVIPNYNVM 160
229586630  66 KEKWGSFDFLLHGMAFADKNELKGRYVDTNLENFHNSLHISCYSLLELSRSAEALMHNGGSIVTLTYYGAEKVIPNYNVM 145
157964443  81 KEKWGSFGFLLHGMAFADKNELKGRYVDTSLENFHNSLHISCYSLLELSRSAEALMHDGGSIVTLTYYGAEKVIPNYNVM 160
67458967   81 KEKWGSFDFLLHGMAFADKNELKGRYVDTSLENFHNSLHISCYSLLELSRSAEALMHDGGSIVTLTYYGAEKVIPNYNVM 160
238651029  81 KEKWGSFDFLLHGMAFADKNELKGRYVDTSLENFHNSLHISCYSLLELSRSAEALMHNGGSIVTLTYYGAEKVIPNYNVM 160
15892417  161 GVAKAALEASIKYLANDMGENNIRVNAISAGPIKTLASSAIGDFSTMLKSHAATAPLKRNTTQEDVGGAAVYLFSELSKG 240
15604232  161 GVAKAALEASVKYLANDMGENNIRVNAISAGPIKTLASSAISDFSTMLKSHAATAPLKRNITQEDVGGAAVYLFSELSKG 240
157828365 161 GVAKAALEASIKYLANDMGENNIRVNAISAGPIKTLASSAIGDFSTMLKSHAATAPLKRNTTQEDVGGAAVYLFSELSKG 240
165933073 161 GVAKAALEASIKYLANDMGENNIRVNAISAGPIKTLASSAIGDFSTMLKSHAATAPLKRNTTQEDVGGAAVYLFSELSKG 240
51473557  161 GVAKAALEASVKYLANDMGENNIRVNAISAGPIKTLASSAISDFSTMLKFHASTAPLKRNITQEDVGGAAVYLFSELSKG 240
157825627 161 GISKAALEASVKYLANDLGKNNIRVNAISAGPIKTLASSAIGDFSTMLKSHATNAPLKRNTTQEDVGGAAVYLFSNLSQG 240
157803894 161 GISKAALEASVKYLANDMGENNIRVNAISAGPIKTLASSAIGNFSTMLKSHAATTPLKRNTTQEDVGGAAIYLFSNLSKG 240
91206070  161 GVAKAALEASVRYLANDMGENNIRVNAISAGPIKTLSGSVIGDFNSMLRSHAATAPLKRNTLQQDVAGAAVYLFSQLASG 240
157826574 161 GVAKAALEASVRYLANDMGENNIRVNAISAGPIKTLSGSVIGDFNSMLRSHAATAPLKRNTLQQDVAGAAVYLFSQLASG 240
229586630 146 GVAKAALEASIKYLANDMGENNIRVNAISAGPIKTLASSAIGDFSTMLKSHAATAPLKRNTTQEDVGGAAVYLFSELSKG 225
157964443 161 GVAKAALEASIKYLANDMGENNIRVNAISAGPIKTLASSAIGDFSTMLKSHAATAPLKRNTTQEDVGGAAVYLFSELSKG 240
67458967  161 GISKAALEASVKYLATDLGENNIRVNAISAGPIKTLASSAIGDFSTMLKSHAATAPLKRNTTQEDVGGAAVYLFSNLSKG 240
238651029 161 GVAKAALEASIKYLANDMGENNIRVNAISAGPIKTLASSAIGDFSTMLKSHAATAPLKRNTTQEDVGGAAVYLFSELSKG 240
15892417  241 VTGEIHYVDCGYNIMGSTKL 260
15604232  241 VTGEIHYVDCGYNIIGSSKL 260
157828365 241 VTGEIHYVDCGYNIMGSNKL 260
165933073 241 VTGEIHYVDCGYNIMGSNKL 260
51473557  241 VTGEIHYVDCGYNIIGSSKL 260
157825627 241 VTGEIHYVDCGYNIMGSHKL 260
157803894 241 VTGEIHYVDCGYNIMGSNKL 260
91206070  241 VTGEIHYVDCGYNVMGSNKI 260
157826574 241 VTGEIHYVDCGYNVMGSNKI 260
229586630 226 VTGEIHYVDCGYNIMGSNKL 245
157964443 241 VTGEIHYVDCGYNIMGSNKL 260
67458967  241 VTGEIHYVDCGYNIMGSNKL 260
238651029 241 VTGEIHYVDCGYNIMGSNKL 260
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap