Conserved Protein Domain Family
PRK06588

?
PRK06588: PRK06588 
putative monovalent cation/H+ antiporter subunit D; Reviewed
Statistics
?
PSSM-Id: 168619
View PSSM: PRK06588
Aligned: 12 rows
Threshold Bit Score: 669.181
Threshold Setting Gi: 15604151
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
91205837    1 MFQNTKLSFFLANFELVFDFSTQNQLIAVAFLLITAIANLYAISQNRKLESLIGSLYCLSSLICLFSGDFISMIISLEFM 80 
15604151    2 FIQNTKFIFPVTNFNLIFDFNPQNQLIALSFIIVTTILNIYTISKKRKLECLIGSLYCLSSIACIFAADFISMIISIEFM 81 
51473478    2 FIQNTKFTFPFTNFNLIFDFNPQNQLIALSFIIITTILNLYTISKKRKLECLIGSLYCLSSIVCVFAADFISMIISIEFM 81 
15892301    2 FIQNTKCTFPLTNFELMFDFHPQNQLIALAFLIVTAILNLYTISQNRKLECLIGSLYCLSSIICVFAADFISMIISLEFM 81 
67458847    2 FIQNSKFIFPLTNFELMFDFNLQNQLIALAFLIVTAILSLYTISQNRKLETLIGSLYCLSSIICVIAADFISMIISLEFM 81 
157828255   2 FIQNTKCTFPLTNFELIFDFHPQNQLIALAFLIVTAILNLYTISQNRKLECLIGSLYCLSSIICVFAADFISMIISLEFM 81 
157964354   4 FIQNTKCTFPLTNFELMFDFHPQNQLIALAFLIVTAILNLYTISQNRKLECLIGSLYCLSSIICVFAADFISMIISLEFM 83 
157825500   2 FIQNTRFTFPITNFELMFDFNPQNQLIALAFLIVTAILNLYTISQNRKFETLIGSLYCLSSIICVFAADFISMIISLEFM 81 
157804006   2 FIQNTIFALPLANFELAFDLTPQNQLIALAFLIVTTILNLYTISQNRKFETLIGSLYCLSSIICVLAADFISMIIAFEFM 81 
165932956   2 FIQNTKCTFPLTNFELIFDFHPQNQLIALAFLIVTAILNLYTISQNRKLECLIGSLYCLSSIICVFAADFISMIISLEFM 81 
229586532   2 FIQNTKCTFPLTNFELMFDFHPQNQLIALAFLIVTAILNLYTISQNRKLECLIGSLYCLSSIICVFAADFISMIISLEFM 81 
238650727   2 FIQNTKCTFPLTNFELMFDFHPQNQLIALAFLIVTAILNLYTISQNRKLECLIGSLYCLSSIICVFAADFISMIISLEFM 81 
91205837   81 TIFACIIVFIGSCSVKHTRQYFLTHLFSSGLILTGMSLLIDKTANIAFTPLTTAIYNSELPAILILAGCLINASIIFFNG 160
15604151   82 TIFTCIIIFCEQLKIQPLRQYFITHLLSSELILIGITLRIQTTSNTAFISLTESVNHFKLPEIFILTGCLINASAIFVNG 161
51473478   82 TIFTCIIIFCEQLKIQPLRQYFITHLFSSGLILIGMTLQITTISNTAFISLTESVNHFKLPSILILTGCLINAATIFVNG 161
15892301   82 TIFACIIIFCDQLKIKPARQYFLTHLFSSGLILIGMTLLIQTTSNTTFTSLTESVNNFELPAIFILAGCLINASAIFVNG 161
67458847   82 TIFVCIIVFCDQLKIKPARQYFLTHLFSSGLILIGMTLLIQATGNTAFISLTESVYNFELPAIFILAGCLINLGTIFVNG 161
157828255  82 TIFACIIIFCDQLKIKPARQYFLTHLFSSGLILIGMTLLIQTTSNTTFTSLTASVNNFELPAIFILAGCLINASAIFVNG 161
157964354  84 TIFACIIIFCDQLKIKPARQYFLTHLFSSGLILIGMTLLIQTTSNTTFTSLTESVNNFELPAIFILTGCLINASAIFVNG 163
157825500  82 TVFACIIVFCNQLKIKPARQYFLTHLFSSGLILIGMTLLIQTTGNIAFTSLTESVNNFELPAIFILAGCVINASIIFVNG 161
157804006  82 TIFACIIIFCYQLKIKPVRQYFLTHLFSSGLILIGMTRLIQTTGNTTFIPLNELVYNAELPAIFILAGCLINASAIFVNG 161
165932956  82 TIFACIIIFCDQLKIKPARQYFLTHLFSSGLILIGMTLLIQTTSNTTFTSLTASVNNFELPAIFILAGCLINASAIFVNG 161
229586532  82 TIFACIIIFCDQLKIKPARQYFLTHLFSSGLILIGMTLLIQTTSNTTFTSLTESVNNFELPAIFILAGCLINASAIFVNG 161
238650727  82 TIFACIIIFCDQLKIKPARQYFLTHLFSSGLILIGTTLLIQTTSNTTFTSLTESVNNFELPAIFILAGCLINASAIFVNG 161
91205837  161 WVVNCYPKASSSGMIYLLSFTTKIALITIFKLFSGLEILKFCGLAMIIYGLIFALIEKNLRRLICYLTVSQLGFILAAIG 240
15604151  162 WVVNCYPAASSSGVVYLISFTTKVSLIIILKLFSGLEILKLFGISIMIYGLVFSLIEKNLKRLICYLTISQLGFILAAIS 241
51473478  162 WVVNCYPAASSSGVVYLISFTTKVSLIIILKLFSGLEILKLFGISMMIYGLVLSLIEKNLKRLICYLTISQLGFILAAIS 241
15892301  162 WVVHCYPIASSSGIVYLISFTTKVILIIILKLFSGLEILKFFGISMIIYGLVLSLIEKKLKRLICYLTVSQLGFILTAIS 241
67458847  162 WVVNCYPAASGSGIVYLTSFTTKVTLIIILKLFSGLEILKFFGISMIIYGLIFSLIEKNLKRLICYLTVSQLGFILAAIS 241
157828255 162 WVVHCYPIASSSGIVYLISFTTKVILIIILKLFSGLEILKFFGISMIIYGLVLSLIEKKLKRLICYLTVSQLGFILTAIS 241
157964354 164 WVVHCYPIASSSGIVYLISFTTKVTLIIILKLFSGLAILKFFGISMIIYGLVLSLIEKKLKRLICYLTVSQLGFILTAIS 243
157825500 162 WVVNCYTAASSSGVVYLISFTTKVTLIIILKLFSGLEILKFFGILMIIYGLVFSLIEKNLKRLICYLTVSQLGFILAAIS 241
157804006 162 WVVNCYPIASSSGVVYLISFTTKVTLIIILKLFSGLEILKFFGISMIIYGLVFSLIEKNLKRLICYLTVSQLGFILTAIS 241
165932956 162 WVVHCYPIASSSGIVYLISFTTKVILIIILKLFSGLEILKFFGISMIIYGLVLSLIEKKLKRLICYLTVSQLGFILTAIS 241
229586532 162 WVVHCYPIASSSGIVYLISFTTKVILIIILKLFSGLEILKFFGISMIIYGLVLALIEKKLKRLICYLTVSQLGFILTAIS 241
238650727 162 WVVHCYPIASSSGIVYLISFTTKVILIIILKLFSGLEILKFFGISMIIYGLVLSLIEKKLKRLICYLTVSQLGFILTAIS 241
91205837  241 INSPRILYLIPIFIFMHILYNGVFALYFAIIEDSNKIKNYQDLKTTKYNPILLIGFILTILIYSSILPINSSYIKLELVN 320
15604151  242 INAPNIDYLITSFIFMHILYNSLFALYFTYIEDEYGIKNYQDLHKSSINLILLIGFVISILIYISILPISSSDIKDAIAN 321
51473478  242 INTPNIAYLITSFIFMHILYNGLFALYFTYIEDEYGIKNYQDLHKSSINLNLLIGFVISILIYISILPMRSSYIKNAIAN 321
15892301  242 IKSPNIAYLITSFIFIHILYNGLFALYFAYIEDEYDIKNYQDLQNTQINFILLSGFVISILIYTSILPIRSSYIKDEIAN 321
67458847  242 INSPNIAYLITSFIFIHILYNGLFALYFTYIEDEYSIKNYQDLQNTQVNLILLGGFVVSILIYTSILPINSSYIKDGIAN 321
157828255 242 INSPNIAYLITSFIFIHILYNGLFALYFAYIEDEYDIKNYQDLQNTQINFILLSGFVISILIYTSILPISSSYIKDEIAN 321
157964354 244 INSPNIAYLITSFIFIHILYNGLFALYFAYIEDEYDIKHYQDLQNTQINFILLSGFVISILIYTSILPISSSYIKDEIAN 323
157825500 242 INSPNIAYLITSFIFIHILYNGLFALYFTYIEDEYSIKNYQDLQNTQINLILLGGFVVSILIYTSILPINSSYIKDGIAN 321
157804006 242 INSPSIAYLITSFIFIHILYNGLFALYFTYIEDEYNIKNYQDLKTTT-NPILLIGFIISILIYTSILPISSSYIKDEIAN 320
165932956 242 INSPNIAYLITSFIFIHILYNGLFALYFAYIEDEYDIKNYQDLQNTQINFILLSGFVISILIYTSILPISSSYIKDEIAN 321
229586532 242 INSPNIAYLITSFIFIHILYNGLFALYFAYIEDEYDIKNYQDLQNTQINFILLSGFVISILIYTSILPIRSSYIKDEIAN 321
238650727 242 INSPNIAYLITSFIFIHILYNGLFALYFAYIEDEYDIKNYQDLQNTQINFILLSGFVISILIYTSILPISSSYIKDEIAN 321
91205837  321 ALNENYVMIFFKIATCTILFSLVFEGVLALLQVSNkevtrHCERLQGAWQSHFIILrllrqnLQFFLAMTPVYLLYLSSC 400
15604151  322 ILNEKNIMIFFKIITCTVLFELLLESLHLLYRRTL-----RICSTNIKLFSIIEYFq----nNVVKTRHDIIKILYLHFC 392
51473478  322 ILNEENIMLFFKIITCTVLFELLLESLHLLYRRAS-----RICNTNIKPFSIIEYFl----nNALKTRHDIITILYLHCC 392
15892301  322 ILNENSVMLFSKIATCTVLFGLLMESSTSFLRK-------QESSKNLKNKSFIIFL------DSRFRRNDIRTITYLSFC 388
67458847  322 LLDANNIIIFSKIATCTVLFGLLIESLPSL----------RATKRSVAISSNILRLra--ykTTFFLAMTLRNLTYLSLC 389
157828255 322 ILNENSVMLFSKIATCTILFGLLMESSKSFPSRFMsflrkQESRNIIKLLFLRFLL------DSCFRRNDIRTITYLSFC 395
157964354 324 ILNENSVMLFSKIATCTVLFGLLMESSTSFPPLFMsflrkQESSKNLKNKSFIIFL------DSCFRGNDIRTIPYLSFC 397
157825500 322 LLETNNIIIFSKIATCTVLFGLLMESLYNLSYRD------QVDGSRKKINNDNKYL------WITRSSRGITPITYLSSC 389
157804006 321 ILNANNVMLFAKIVTCTVLFRLLLESIGDLSYHDLi----AISRKKINNDNKYLWI--------LRSSRGMISVVYLSFC 388
165932956 322 ILNENSVMLFSKIATCTILFGLLMESSKSFPSRFMsflrkRESRNIIKLLFLRFLL------DSCFRRNDIRTITYLSFC 395
229586532 322 ILNENSVMLFSKITTCTVLFGLLMESSTSFLRK-------QESSKNLKNKSFIIFL------DSCSRRNDIRTITYLSFC 388
238650727 322 ILNENSVMLFSKIATCTVLFGLLMESSTSFPSLFMsflrkQESSKNLKNKSFIIFL------DSRFRGDYIRTITYLSFC 395
91205837  401 LITLAICAFYPVQISDVNN--NLSIILIAFFLALLFRSSPRILTKNINLDLYRYIQKIIYFCITKYKETKSdEIEEDEYL 478
15604151  393 IMTLFLCLFYPIQISHKTNsnQLIILTISLLLALIFRKIPRISTENINLDLYQYIEKLIFFIVDKYTEKYN-KKNAKAYI 471
51473478  393 IITLFLCLLYPIQISHNTNsnQLIIITISLLLALIFRKIPRISTENINLDLYQYIEKLIFFIVDKYTEKYD-KKNVEAHI 471
15892301  389 IITLCICLFYPIQISHTANf-KLVILAISLLLALIFRKIPRISTENINLDLYQYIEKFIYFSIDKYKETADnNEDAAEYL 467
67458847  390 IITLCVCLFYPIQISHNANf-KLVILAISVLLTLIFRKIPRISTENINLDLYQYIEKFIYFIIDKYKERTDsTEDTEEYL 468
157828255 396 IITLCICLFYPIQISHTANf-KLVILAISLLLALIFRKIPRISTENINLDLYQYIEKFIYFSIDKYKETADnNEDAAEYL 474
157964354 398 IITLCICLFYPIQISHTANf-KLVILAISMLLALIFRKIPRISTENINLDLYQYIEKFIYFSIDKYKKTADnNEDAAEYL 476
157825500 390 IITLSVCLFYPVQISHTANf-KLVILAISILLALIFRQIPRISTENINLDLYQYIEKMIYFSIDKYKYTTDsNEDGEKYL 468
157804006 389 IITLCVCLFYPVQIPHTANf-KLVIPAISLLLALIFRKIPRISTQHINLDLYQYIEKLIYFSIAKYKETADnNEDTEEYL 467
165932956 396 IITLCICLFYPIQISHTANf-KLVILAISLLLALIFRKIPRISTENINLDLYQYIEKFIYFSIDKYKETADnNEDAAEYL 474
229586532 389 IITLCICLFYPIQISHTANf-KLVILAISLLLALIFRKIPRISTENINLDLYQYIEKFIYFSIDKYKGTADnNEDAAEYL 467
238650727 396 IITLCICLFYPIQISHTANf-KLVILAISLLLALIFRKIPRISTENINLDLYQYIEKFIYFSIDKYKETADnNEDAAEYL 474
91205837  479 NFKAFWQDTLSKISTWHNGQTAIFIIVLMLVSLILVL 515
15604151  472 NFKAILDNILIKISAWHNQQTAIFIVLFLLISFILTL 508
51473478  472 NLKAILDNILSKISAWHNQQTAIFIVLFLLISFILTL 508
15892301  468 NFKVIWDNILSKISAWHNQQTAILIVLFLLISLILTL 504
67458847  469 NFKVIWDNILGKISAWHNQQTAIFIILFLLISLILTL 505
157828255 475 NFKVIWDNIFSKISAWHNQQTAILIVLFLLISLILTL 511
157964354 477 NFKVIWANILSKISAWHNQQTAILIVLFLLISLILTL 513
157825500 469 NFKVIWNNISSKIPAWHNQQTAIFIVLFLLIGLILTL 505
157804006 468 NFKVIWVNILSKIFAWHNQQTAIFIVLFLLISLILTL 504
165932956 475 NFKVIWDNIFSKISAWHNQQTAILIVLFLLISLILTL 511
229586532 468 NFKVIWDNILSKISAWHNQQTAILIVVFLLISLILTL 504
238650727 475 NFKVIWDNILSKISAWHNQQTAILIVLFLLISLILTL 511
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap