Conserved Protein Domain Family
PRK06568

?
PRK06568: PRK06568 
F0F1 ATP synthase subunit B; Validated
Statistics
?
PSSM-Id: 168615
View PSSM: PRK06568
Aligned: 13 rows
Threshold Bit Score: 211.693
Threshold Setting Gi: 91206108
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
91206108    1 MHFLDESFWLAISFIIFVYLIYRPAKKAILKSLDMKVLEVQERVLKAEKLKDDAKLLFEQTEEQIKNLEALQLQMTKENN 80 
15891947    1 MNFLDESFWLAVSFVIFLYLVYRPAKKAILNSLDAKILEVQEKVLQAEKLKEDAALLFKHTNAQIKKLETLRSQMIEDSN 80 
15603899    1 MNFLDESFWLTISFVIFVYLIYRPAKKAILNALDTKISEIQEKVLKAKKLKEDAALLFEQTKLQIQKLETLRSQMIEESD 80 
157827894   1 MNFLDESFWLAVSFIIFLYLVYRPAKKAILNSLDAKILEVQEKVLQAEKLKEDAALLFKHTNAQIKKLETLRSQLIEESN 80 
165932582   1 MNFLDESFWLAVSFIIFLYLVYRPAKKAILNSLDAKILEVQEKVLQAEKLKEDAALLFKHTNAQIKKLETLRSQLIEESN 80 
51473319    1 MNFLDESFLLAVSFVIFIYLIYRPAKKAILNSLDTKIIEIQEKVLKAKKLKEDAALLFEQTKVQIQKLEALRSQMIEESD 80 
157825174   1 MNFLDESFWLAVSFVIFVYLIYRPAKKAILNSLDAKILEVQEKVLKSEKLKEDAALLFEQTNAQIQKLEALRSQMIEESN 80 
157803206   1 MNFLDENFCLAVSFVIFVYLIYKPAKKAILNSLDVKILEIQERVLKAKKLKEDAILLFEQTNAQIKQLDTLRSQMIEESN 80 
157826459   1 MHFLDESFWLAISFIIFVYLIYRPAKKAILKSLDMKVLEVQERVLKAEKLKDDAKLLFEQTEEQIKNLEALQLQMTKENN 80 
229586250   1 MNFLDESFWLAVSFVIFLYLVYRPAKKAILNSLDAKILEVQEKVLQAEKLKEDAALLFKHTNAQIKKLETLRSQMIEDSN 80 
157964085   2 MNFLDESFWLAVSFVIFVYLVYRPAKKAILNSLDAKILEVQEKVLKAEKLKEDAALLFKHTNAQIKKLETLRSQMIEESN 81 
67458419    1 MNFLDESFWLAVSFIIFVYLIYRPAKKAILNSLDAKILEVQEKVLKAEKLKEDAALLFEQTNAQIQKLETLRSQMIEESN 80 
238650337   1 MNFLDESFWLAVSFVIFLYLVYRPAKKAILNSLDAKILEVQEKVLQAEKLKEDAALLFKHTNAQIKKLETLRSQLIEESN 80 
91206108   81 EITEKIVQEKTKEIEEFLEHKKVETIKLIESQKLLASKELQDEFSDEVVKLVSEYFHSTKnnnLSETDIAKNLMDKV 157
15891947   81 EVTKKIIQEKTKEIEEFLEHKKSDAIQLMQNQKSTASKELQDEFCDEVIKLVSEYFQSVK---LSESNIAKNLMDKS 154
15603899   81 KATKQIIQDKTKEMEEFLERKKADAIQLIQNQKSTASKDLQDEFCDEVITLVSKYFRSAK---LSEKSIAKNLMDKS 154
157827894  81 EVTKKIIQEKTKEIEEFLEHKKSDAIQLMQNQKSTASKELQDEFCDEVIKLVSEYFQSVK---LSESNIAKNLMDKS 154
165932582  81 EVTKKIIQEKTKEIEEFLEHKKSDAIQLMQNQKSTASKELQDEFCDEVIKLVSEYFQSVK---LSESNIAKNLMDKS 154
51473319   81 KATQKIIQDKTKAMEEFLEQKKADAIQLIQNQKLIASKDLQDEFCDEVITLVSKYFRSVQ---LSERSIAKNLMDKS 154
157825174  81 EVTKKLIQEKTKEIEEFLEHKRSDAIQLIQNQKSTASKELQDEFCDEVITLVSKYFQSAR---LSESNIAKNLMDKS 154
157803206  81 KVTKKIIQEKTKEIEEFLEHKKSDAIKLIQHQKLITSKELQDEFCDEVIKLVSKYFQSVK---LSESNIAKNLMDKS 154
157826459  81 EITEKIVQEKTKEIEEFLEHKKVETIKLIESQKLLASKELQDEFSDEVVKLVSEYFHSTKnnnLSETDIAKNLMDKV 157
229586250  81 EVTKKIIQEKTKEIEEFLEHKKSDAIQLMQNQKSTASKELQDEFCDEVIKLVSEYFQSVK---LSESNIAKNLMDKS 154
157964085  82 EVTKKIIQEKTKEIEEFLEHKKSDAIQLMQNQKSTASKELQDEFCDEVIKLVSEYFQSVK---LSESNIAKNLMDKS 155
67458419   81 EVTKKIIQEKTKEIEEFLEHKKSDAIQLIQNQKSTATKELQDEFCDEVIKLVSEYFQSAK---FSESNIAKNLMDKS 154
238650337  81 EVTKKIIQEKTKEIEEFLEHKKSDAIQLMQNQKSTASKELQDEFCDEVIKLVSEYFQSVK---LSESNIAKNLMDKS 154
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap