Conserved Protein Domain Family
PRK06548

?
PRK06548: PRK06548 
ribonuclease H; Provisional
Statistics
?
PSSM-Id: 75628
View PSSM: PRK06548
Aligned: 2 rows
Threshold Bit Score: 322.534
Threshold Setting Gi: 28493206
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
28493206   1 MTNNEIIAATDGSSLANPGPSGWAWYVDENTWDSGGWDIATNNIAELTAVRELLIATRHTDRPILILSDSKYVINSLTKW 80 
28572680   1 MTNNEIIAATDGSSLANPGPSGWAWYVDENTWDSGGWDIATNNIAELTAVRELLIATRHTDRPILILSDSKYVINSLTKW 80 
28493206  81 VYSWKMRKWRKADGKPVLNQEIIQEIDSLMENRNIRMSWVNAHTGHPLNEAADSLARQAANNFSTRSAHIPGPGWTERSA 160
28572680  81 VYSWKMRKWRKADGKPVLNQEIIQEIDSLMENRNIRMSWVNAHTGHPLNEAADSLARQAANNFSTRSAHIPGPGWTERSA 160
28493206 161 K 161
28572680 161 K 161
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap