Conserved Protein Domain Family
PRK06495

?
PRK06495: PRK06495 
enoyl-CoA hydratase/isomerase family protein
Statistics
?
PSSM-Id: 168580
View PSSM: PRK06495
Aligned: 12 rows
Threshold Bit Score: 433.737
Threshold Setting Gi: 110636077
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
239820541  10 SLAELQVHIVDQHIAVLTLNSPPVNALTRRLNDELIWALDRISELDELRAVVLTGAGKIFCAGADLKGRAEVIKEPGDLR 89 
16126058   19 QMMSCLKIEVEDFVATVTLANPPVNSASVDMMLELTAAFDAFNESPDVRAVLLTAEGKTFCAGADLKNRPGPDAPAGTAF 98 
221234828  19 QMMSCLKIEVEDFVATVTLANPPVNSASVDMMLELTAAFDAFNESPDVRAVLLTAEGKTFCAGADLKNRPGPDAPAGTAF 98 
27378556    1 MSGDIVTLEVSDHIALVTLNRPPVNALDRAMRDRIVSVFDEISERSDVRVAILTGAGKVFCSGADLKDRPDP-TKIGAFH 79 
50084967    1 MLNQLIKTEISQHVAVVTLNNPPVNAQSREFVEELISVFDELNDTPEVRVIVLTGQGKVFSAGADIKSRGNVGEIPGETY 80 
163858212   7 GPYTALDVTLDGGVAVILLANPPVNALSTEMMNELSWVLDRISETPEVRAVVLSGQGKTFCAGADLKNRATTIKGPGDLP 86 
239820174   1 ---MSIELEVSEYIAVVRLDKPPVNALDRATRRRLIEIFDEVSERADVRVAILTGTGKFFCSGADLKDRPDA-QKAGDFL 76 
239820803   2 DNFLQLEVAIAAHVATLTLNAPPVNALTRVLNDELTRAFDQISEMDDVRAVILTGEGKVFCAGADLKGRAEVIKGPGDLM 81 
116694372   2 NDWTQLKLSVDRHIAVVTMDAPPVNALTRGLNDELVAVLDQLSDTPEVRVIVLTGAGKVFCAGADIKGRGALVDGPGALR 81 
87199550    1 --MNSILTDVKDNVAVVTMANPPVNAIAMEMLQELTEVFDSFNDQEDVRVAVLTGAGKCFSAGADLKGRPDL-SVPGARW 77 
87199579    1 --MSQVRLDVSDYVAVVTIDNPPVNAQNMDLVDELIATFDSFNDRDDVRVAVLTGAGKCFSAGADLRNRPDL-SAPGARW 77 
110636077   1 -MPATHSVKIEDFMATVTIDRPPVNAQNRELRRELIETFDSLGDRDDVRVVILTAAGKYFSAGADLKERQSFEGSEGEYT 79 
239820541  90 AHSRRTRECFHAIRECSKPVVAAINGAALGSGLAMVASSDVLIASERASLGLPEVDVGLLGGCSHAMRLFGHSRVRRMML 169
16126058   99 ARQRMAREMSWSMVECSKPVVVAVNGAALGAGLGIVASCDIIVASERAVFGLPEIDVGLAGGAKHAVRFIPHSLARRMVL 178
221234828  99 ARQRMAREMSWSMVECSKPVVVAVNGAALGAGLGIVASCDIIVASERAVFGLPEIDVGLAGGAKHAVRFIPHSLARRMVL 178
27378556   80 SHNRITREAGNCIRECSKPVIAAINGVALGAGVGLMASCDIFYACEEAVFGMPEINVGLAGGAAMLNTLFGRSLMRRMFF 159
50084967   81 RHLRRTREVGFCIMESNKPVIAAVNGPALGAGLGLVLCSDIILASENAVFGLPEIDIGLMGGVRHTMRLFPHSLTRRMVL 160
163858212  87 QHSRRTRECFHAIRECAKPVVGAINGAALGAGLAIVASCDILLAASTATVGLPEINVGLLGGGRHGMRLFSHSRLRRMML 166
239820174  77 DHNRWTRETGNAIRECAKPVIAAVNGPALGAGFGLMAACDIFLASEDATFAMPEINVGLAGGVSMLRTMFGRSFTRRMFF 156
239820803  82 AHSRRTRECFHAIRECAKPVVCAINGAALGSGLAMAASSDILIASEKASLGLPEVDVGLLGGCRHAMRLFGHSRLRRMML 161
116694372  82 AHSRRTRECFHAIRECAKPVVAALNGPALGAGLAIAASADILVASEQASAGLPEIDVGALGGGRHAMRLFGHSRVRRMML 161
87199550   78 SRNRIVREVAYAIADCAKPVIAAVNGPALGAGFGLVASCDIIVASENAVFGLPEIDVGLMGGGKHSSRIVPHSLTRRMML 157
87199579   78 ARNRKVREVSYCIIDNAKPTIAAVNGPALGAGLGLVASCDIIVASENAVFGLPEVDVGLMGGGKHAERILPHSLVRRMML 157
110636077  80 AHNRLTREFFYSVRDCAKPVIAAVNGPAFGAGFALMLACDIMYATEDSYFVMPEINVGLAGGVKFISEHFSKSRTNAMYL 159
239820541 170 TGWRVPADELYRTGVVEVCTPHDELMPTALEMARTIAAKSPVSTRMGKHALNTLEDMgaSLRDGYRYEQDMTAQIGQTAD 249
16126058  179 TGWRVPAEELYRRGLIEAALPHEEFLDYARGIAKEIASKSPVAVAAAKDSLNVIDNL--SLRDGYRYEQGNTYKLSKSED 256
221234828 179 TGWRVPAEELYRRGLIEAALPHEEFLDYARGIAKEIASKSPVAVAAAKDSLNVIDNL--SLRDGYRYEQGNTYKLSKSED 256
27378556  160 TGYRVPATELYRLGIIEACTTKENLIPEVMKLAREIASKSPIAMEYAKNAANMVELM--PPRDAYRFEQNITMALSKTED 237
50084967  161 SGYRVTAAELYRRGIIEACTTPDQLMEEALAIAHSIASKSPAALKLAKRAINTVETM--GLKEGYRFEQNLTVEMTRHED 238
163858212 167 TGLRIDGDELYRLGVVEASVPSEALMDEAMALARELASKSPLATVLAKQTLNAIEDM--SLRDGYRYEQDMTAAIAKTED 244
239820174 157 TGMKVPAAELYRRGVLDEVVPGEQLMPLAMEIAQEIASKAPLAVAYAKQAANMMDLM--PQRDGYRFEQNITMALARTED 234
239820803 162 TGMRVPGAELYRLGIVEACTAPEDLMPAAREIAAAIASKSPVSTRMGKHTLNVIEDM--SLRDGYRYEQDMTAQIAKTDD 239
116694372 162 TGYRVPAPELYRLGIVEACVAPDALMPAALELAEQVASKSPVVSQLAKHTLNTIEHM--GLRDGYRYEQDQTAILSKTED 239
87199550  158 TGYRVPASEMYRRGIIEACLPADELLPYCMDMAAVIASKSPLATRYAKDSMRTIENM--TLRDGYIYEQGNTAKLASSHD 235
87199579  158 TGYRAPAEELYRRGVIEACLPPEELMPWVMDMARNIAAKSPLATRLAKDSMRTIENM--TLRDGYVYEQGNTAKLATSQD 235
110636077 160 TGDRYPASELYRLGVIEAALPADEMWREVRRVARSIASKSPLAVSRIKAALAVIETM--PVREAYRYEQSITSDLAKSED 237
239820541 250 AKEAQAAFREKRAPVFIGR 268
16126058  257 AKEAVRAFIEKRPPVFQGR 275
221234828 257 AKEAVRAFIEKRPPVFQGR 275
27378556  238 AKEARMAFLEKRTPVFKGR 256
50084967  239 SKEAMRAFLEKRQPVFKDS 257
163858212 245 AQEARRAFLEKRAPVFQGR 263
239820174 235 AQEARKAFLEKRKPVYKGR 253
239820803 240 AKEAQRAFAEKRTPVFTGR 258
116694372 240 CREAQAAFREKRAPVFVGR 258
87199550  236 AGEAVAAFVEKRPPVFLGR 254
87199579  236 AAEAVAAFVEKRPPVFLGR 254
110636077 238 ANEAQRAFIEKRQPIFKRR 256
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap