Conserved Protein Domain Family
PRK06488

?
PRK06488: PRK06488 
sulfur carrier protein ThiS; Validated
Statistics
?
PSSM-Id: 168577
View PSSM: PRK06488
Aligned: 11 rows
Threshold Bit Score: 104.414
Threshold Setting Gi: 240850177
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
150376314  1 MKLTINGEEHEVQADTLAELLQYLEFEGDWLATAVNGELVQKAERADRRLQDSDRIEVLSPMQGG 65 
15889825   1 MKLLVNGDELDLAAETLAGLLASLDYEGEWLATAVNGDLVHSEERAGYVLKAFDRVEILSPMQGG 65 
13474821   1 MKLLVNGKAHEVAATTLAELLAALDYEGDWLATAVNSDLVHKASRAEFRLSDGDRIEILSPMQGG 65 
49475284   1 MQIFVNGETIETEVITLNLLLEELGYEGNWLATAVNAEVVPIDARSRCVLHEGDKIEILSPMQGG 65 
121602362  1 MKIFVNDEIIQTDVTYLNLLLEELGYKGNWLATAVNSEVVSSDARGQYALHEGDRIEILSPMQGG 65 
49474047   1 MQIFVNGETIQTEVISLDLLLKKLGYEGNWLATAVNAEVIPVDARSQFVLHEGDKIEILSPMQGG 65 
163867972  1 MQIFVNGEKLQTEATFLNLLLVELGYEGNWLATAVNAEVVPLEARNQFILHEGDKVEILSPMQGG 65 
209552236  1 MQLIINGEAQTIAATTLSQLLAALDYEGDWLATAVNGELVHREDRDEHMLTDNDRIEILTPMQGG 65 
222081142  1 MRLIVNGEPQTITVKTLSELLVTLDYEGDWLATAVNGELVHREDRADHALNDNDRIEILTPMQGG 65 
222106878  1 MKLIVNGEPLDCSAPTLSALLKQLDYEGEWLATAINGDLVHAEDRQGCALNEGDRIEILSPMQGG 65 
240850177  1 MQIFVNGETVQTEVMTLGLLLEELGYEGNWLATAVNAEVVSIDARSQFVLHEGDKIEILSPMQGG 65 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap