Conserved Protein Domain Family
PRK06484

?
PRK06484: PRK06484 
short chain dehydrogenase; Validated
Statistics
?
PSSM-Id: 168574
View PSSM: PRK06484
Aligned: 5 rows
Threshold Bit Score: 744.363
Threshold Setting Gi: 87199578
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
50084974    1 MNTQRKVAIVTGANGGIGRVICQSLASAHYLIAGLDREGIDLERNMSQLGTEHRAYVCDLADDQQIQRVVKEIAAHYGHI 80 
16126059    3 SKAQSRVVLVTGGADGIGWAACQRFARAGDQVLVADRNVERARERADSLGPDHHAIAMDVSSEAQIREGFEQLHREFGRL 82 
221234829  28 SKAQSRVVLVTGGADGIGWAACQRFARAGDQVLVADRNVERARERADSLGPDHHAIAMDVSSEAQIREGFEQLHREFGRL 107
16519990    5 QVQPGRVIVVTGAAGGIGRALVDIFAANGDVVVAVDLPDSGVIELGQNLGEPHLGLEVDVSREDDVVALRALLEKRFSRI 84 
87199578    6 REGRARLVLVTGAARGIGLACAHRFARAGDRVVMADRDLAACTFEAERLGSRHVALQLDVSDEAAVEHAMDGLLQQFGAF 85 
50084974   81 DLIVNNAAI-GPTMSATIDTSLDEFKQAMSVNWMGPLQLIRQALPWM--PIHGaAIVNIASLAGVVSNPKRNAYSASKAA 157
16126059   83 DVLVNNAGVtDPQPTATLDQTAEEVARLQAINVTGAFLAAREAGRLMieQGHG-AIINLASGAGLVALAKRTSYSASKAA 161
221234829 108 DVLVNNAGVtDPQPTATLDQTAEEVARLQAINVTGAFLAAREAGRLMieQGHG-AIINLASGAGLVALAKRTSYSASKAA 186
16519990   85 EVLVNNAGI-GPTMAATADTALEDFQRALAINLVGAYSVACETAKLM---KPGaAIVNVASLAGLLGNPKRSAYAASKAG 160
87199578   86 DVVINNAGVvDRFARPLLDVPPEDIDRLIGVNLEGPYLVVRAALRTIlaGRRGaAIVNVASGAALRALPGRAAYSMTKAG 165
50084974  158 MISLTRSLACELAHKQIRVNAIAPGYVRTNMVAELETSGKVDLHLVRQRIPMGRLARPEEIAHVVTFLGSEQARYITGSI 237
16126059  162 VISLTRTLACEWAAKGVRVNAVLPGYTRTQMVQDQIDAGLLDPSIVLSRIPLGRMGEPEEMAEGAFFLASDAASYVVGAT 241
221234829 187 VISLTRTLACEWAAKGVRVNAVLPGYTRTQMVQDQIDAGLLDPSIVLSRIPLGRMGEPEEMAEGAFFLASDAASYVVGAT 266
16519990  161 LISITKSLACRWASRGIRVTAVAPGHVRTPMVAELERAGKLDVSAIRRRVPLGRIARPDEIARAVRFLASAQASYITGST 240
87199578  166 VIGMTRAMAIELGPQGIAVNAVLPGYIDTEILLALEREGKFDRAAAAGAIPMGRLGRTDEIAEAVHYLAR--GGYHCGSL 243
50084974  238 VPVDGGWACFNQAGNAHPAQQDIPQSElnvdsplgRSRVVVITGAAQGIGRAIAEKFAAQGDRLILLDLNQEPLEKLRET 317
16126059  242 LVVDGGYTVYGGSGPASTTPAPSPLAP--------SPRVSAITGGGRGIGRCVVDLFHAAGDRLLVIERDAEGAKALAEA 313
221234829 267 LVVDGGYTVYGGSGPASTTPAPSPLAP--------SPRVSAITGGGRGIGRCVVDLFHAAGDRLLVIERDAEGAKALAEA 338
16519990  241 LVVDGGWMSVNQPGGAHQAQDRTPGAEfmrpvedtDARTVIVMGGATGVGAAIARRFAENGDTVVIADGDGEEAVKLAGL 320
87199578  244 LSVDGGVDAYGGSGKASTAVMPHRPVR--------AGDVACVTGGASGIGAVVADRLAGLGWLVAIIDS--------REI 307
50084974  318 LAGEHLSFCVDISDEQQVKQVFHSIQKLYSEIDVLVNNAGIAEQFLPLEQQSVEAIEKLFDINLNGAFCCIRECLNAMq- 396
16126059  314 LGDEHIVVQADITDVAAVEAAFAQAQARWGRLDVLINNAGAADVFKPSLEQTAQDFTSVYDLNFSGPLATAKAAARLM-- 391
221234829 339 LGDEHIVVQADITDVAAVEAAFAQAQARWGRLDVLINNAGAADVFKPSLEQTAQDFTSVYDLNFSGPLATAKAAARLM-- 416
16519990  321 LGDKHLSRRVDRTVETEVVSLFEELRERFGHLDVFVN--GMNEILVPNTEESPEVLKRILDVNLTGAFTCVREAAISM-- 396
87199578  308 ADGPHPAWQADIASEASVESAMAGIAGQLGPVTLLVNNAGIVEPMAKSADQALADFRRTIDVNVKGTIHASRAAARQMig 387
50084974  397 HKAGVVINMGSINSHLAFSPRHAYGASKAAIEMLSRCLTAELAPQGIRVLTLCPGYIQTPGVVQLEQSGRINVENIRRRI 476
16126059  392 SQGGVIVNLGSIAGLGALPQRNAYCAAKAAVTMMSRSLACEWASAGIRVNTVAPGYIETPAVLALKSAGRAQFDKIRRRA 471
221234829 417 SQGGVIVNLGSIAGLGALPQRNAYCAAKAAVTMMSRSLACEWASAGIRVNTVAPGYIETPAVLALKSAGRAQFDKIRRRA 496
16519990  397 RSGSVILNLGASLSLSPLAPSHAYGAYNAGIDMLTRCTAAELGPLGIRTATVAPGYIRTCAANRLAAVAGMDSASLRQRI 476
87199578  388 AGGGAIVNLSSITASLGLPGRNAYCASKSAVTMLTRSLACEWAAHGIRVNAVAPGYILTPAVQALLASGERDMNSVVRRI 467
50084974  477 PLGRLGQPEDIAEAAYFLASPQASYINGAAVYVDGGWTAFGNAGDASSPS 526
16126059  472 PIGRLGDPMEVARTIAFLASPAASYVAGATLTVDGGWTAFGDAGDASDIL 521
221234829 497 PIGRLGDPMEVARTIAFLASPAASYVAGATLTVDGGWTAFGDAGDASDIL 546
16519990  477 PLGRVGDAEEVAEAAYFLASFDASYINGSILHVDGGLISSREAGWGSEVD 526
87199578  468 PVARLGQPDEVADAIAFLASDAASYVTGATLQVDGGYLASGHPPDGPMP- 516
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap