Conserved Protein Domain Family
PRK06444

?
PRK06444: PRK06444 
prephenate dehydrogenase; Provisional
Statistics
?
PSSM-Id: 102381
View PSSM: PRK06444
Aligned: 3 rows
Threshold Bit Score: 298.301
Threshold Setting Gi: 48477908
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
13542181   1 MKVGIIGKQGRLGRVLQAILDE---------NGFDVvENNWDIAFLSVPIGAAISYIEKYD-GPFIEVSSVKTPFKKYAG 70 
16082503   9 LRAAIIGKEGRLGRVLSSILTG---------NGVQI-DDGADLAFLSVPIKAAMEYIERRD-RTYVELSSVKSVFRKYSG 77 
48477908   1 -MEIIIGANGRFGSLLCSLLDDricididniNELGVyIKKADHVFLSVPVDAALNIIDSYDyNNFVEISSVKWPFKKYSG 79 
13542181  71 RIVSIHPLFGPASYKDGVHRTVLFIKDISMPEYRDLIAEMFRGYEIVDTTADVHDKEMAKSLALPYAVAIISKNIDTAFR 150
16082503  78 SIVSIHPLFGPSSYNDGLHRTIIFVTDISNVKYKEIIEEMFRGYDLVSMSAEEHDRMMVSDMVIPYLMSMIARRIEAGYH 157
48477908  80 KITSIHPLFGPMSYNR--INDVIFINDISRDNSLNELNKIFKNWHFIEMTSDEHDLLMSEIMVKPYIISMML-DCKSDIK 156
13542181 151 TKSFDTFKGIVRILENENEEVMLDTINKNPYA-QYMYDIVKNLGMVIQ 197
16082503 158 TRSFDMARSLASIVEGENPEVVMDTIRLNPFS-GMARDMINDVMSVIP 204
48477908 157 TGSYKKLLEVSEIKNKESWKVFNDTLIYNPYTmNVINDLIERLNKTRD 204
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap