Conserved Protein Domain Family
PRK06439

?
PRK06439: PRK06439 
NADH dehydrogenase subunit J; Provisional
Statistics
?
PSSM-Id: 102378
View PSSM: PRK06439
Aligned: 3 rows
Threshold Bit Score: 82.1822
Threshold Setting Gi: 48478479
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16082006  1 MNKYLALAAVILFFIAVIVPVLMMSGTFIPVSQNITFYGYDIFNQYVVPFELISVVIVGAVLGVMYVAKGDE 72 
13541940  1 MNKYLALVSAALFFIATAIPVIVMPGTFVPVSQDISLIGFSFFNVYIVPFELLSVIIVGAVIGVMYVARGEE 72 
48478479  1 MRNKLQKIAIIVFFIIFAVNFAFIRGSFIIRSQNISRIGTELFSTYIIPFELLSLILVAAIIGVMYIAWEER 72 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap