Conserved Protein Domain Family
PRK06438

?
PRK06438: PRK06438 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 102377
View PSSM: PRK06438
Aligned: 3 rows
Threshold Bit Score: 430.821
Threshold Setting Gi: 48477257
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16082577   1 MVKTLVYGLYPRTEKLRRSYNRWERGLMKSQEIAEIVREEKYEFYDLLERSGIDEYTDPLFNWYDILRPIILSMENVKLG 80 
13541955   2 VVKSLVYGIYPRSERLRKAYNRWERGLVGNEEIRRTISEEKDRFYEYVKSVGISEFTDPLFNWHDIFRPIALSVSGVTLG 81 
48477257   2 SVKKLVYGIYPKTNELRLEIGRWERGIIPDSVLNEKINDEKYIFYDKVKDI---YYTDPLYNWYDIFRPLSRIVNGISLG 78 
16082577  81 PLTRYLETNTFYRMPEFYGIPAINRNLVEFGEMDENPPLPAYHLDKNASI--FLPSPYSVFKMSRFMEKISENDFYAALV 158
13541955  82 PLKRYLETNTFYREPEISGHITLQRKLDTFDLLEENPPLPLFALAKGSSI--FLPTPSSFYKMSSVKANIGAEELYKDLV 159
48477257  79 PLTRFLETNTFYRIPEISDVKDFNLEPDKFQKIDDNPPLPLY-LKHGINFhgLLPSPYSFYYMSKTL--MDYNDFNKKIL 155
16082577 159 REYGKIAKTFGVSKVVLFDVFEYGNHNVSYLDPLLDSAKVTLIARGSPSADNFAGLGHRFEYI-VADSMNGDMRKFTRGI 237
13541955 160 NVYSDIIDIFKPRSLVLYEVFPYNGDNLSYLESLNQKISVHLLTKGKISEKNFNGIKHKFESI-ISDDHPEFLKNYAKYY 238
48477257 156 NIYSRILDIYSIKNVVLLDPLYYKNDAYIDLSDFAKKYNVILITSGNVSKLKING---KLESIaVRPDEVDYIINKCSYP 232
16082577 238 GAKVVSAHRTKIEDVAA-GKRPRDDSVELITHDDYMDFLPREIADIKVEILGKMGD 292
13541955 239 GFKIIDVNKTKVEDPNA-DYGIENYEDAIVTSNDYFDFLPREIADIKVEVLGKVGE 293
48477257 233 GISIFSGDNTKMEDLKTiRKEISGYDNVLLTHSTYMDFLPRVIADKKMDLILEA-- 286
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap