Conserved Protein Domain Family
PRK06437

?
PRK06437: PRK06437 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 135906
View PSSM: PRK06437
Aligned: 3 rows
Threshold Bit Score: 99.9042
Threshold Setting Gi: 13540947
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
13540947  2 DDNMITVKGHIKKSVEIDREMSVGDILKDLGLPEEEYVVIVNGKPVLADHTVKKDDDVVILEVFSGG 68 
16082411  1 MIAMIKVRGHIRKELTIESERKVSDLMKDLGLNEDEYVVIVNGSPVLGDHIVKKEDDVTILEVFSGG 67 
48477609  1 ---MIRIKGSENKTIEMDHELTINDIIKQYKIDAERYAIILNGSPATEDENVRPEDDLLFLEVFSGG 64 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap