Conserved Protein Domain Family
PRK06434

?
PRK06434: PRK06434 
cystathionine gamma-lyase; Validated
Statistics
?
PSSM-Id: 102374
View PSSM: PRK06434
Aligned: 3 rows
Threshold Bit Score: 674.309
Threshold Setting Gi: 48478174
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16081253   1 MVSHRYKGFNTKAVQSGELRDPRFGNVTTPIFETSTFVYPNPEKEAYTDHTRDQPYIYTRWGNPTVQAFEEKYAAVEGAE 80 
13541005   2 AEKRLFNGFNTRAVQSGELRDPRFGNVTTPIFETSTFVFPNSEKDAYIDNTRNLPYIYTRWGNPTVQAFEEKYASLEKAE 81 
48478174   1 ----MLNGFNTRAVQAGDLKIREIGNVVTPIFENSTFIYPNSESE-YMDSSSGMPYIYSRWGNPTVQSLEDKYRVLENTG 75 
16081253  81 YALSFSSGMGAITSAITGLLHPGSRMLSLSDLYGQTFYFFNKVLGDLGIKVDYIDTERINSLDFDPSKYDAIYMESITNP 160
13541005  82 HALSFSSGMGAITSVILALAERGDKILSVSDLYGQTFYFLNKVLPEYGISVEYISTDRLNSGEFKPSDYDIIYLESITNP 161
48478174  76 HAVAFSSGMGAITAAVLSNIKK-KRILSIMDLYGQTFQFFSRTLKTLGIHVDFIDVDKLNNLDFDAKNYDLVYAESITNP 154
16081253 161 TLKVPDIRSVSDYAKKSLVIV--DATFASPYNQHPLDLGADVVIHSATKYIGGHSDIVMGVVGTNSKEIFNSLVIRRKTY 238
13541005 162 TLKVPDIKAVSERSTGKKIIV--DATFASPYNQNPLDLGADVVIHSATKYISGHSDVVMGVFSTNDKSIFDKVVVRRKTF 239
48478174 155 LLKVIDIKNVASFCHENDVLFidDATFASPYNQNPVELGADIVVHSATKYISGHSDVIIGIAGTNN--YYNNLIEMRKTL 232
16081253 239 GSNPDPIQAYLALRGLKTLGLRMEKHNRNGMEIATFLRKNDSISRVYYPDTE------MGKKVLSGFGGMVSFEIRRDRD 312
13541005 240 GSNPDPIQSYLALRGIKTLGLRMEKHNKNGMELAKYLRTEPRISHVYYPDTE------IGKKVLRGFGGMISFELRPELD 313
48478174 233 GASPDAFQAYLSYRGLKTLGLRMERHNKNAMELARFLRDSKKVLNVNYPGLDdnkyhgIAGKEMRGYGGMLSFTLNSMED 312
16081253 313 VHSFLRKLSIPMVAASLGGVESLITLPAETSHSSLSREERERMGISDNLVRFSIGIEDAEDLIADIQNALGA 384
13541005 314 VHVFMRNLKIPMVAASLGGVESLITLPVETSHSSMTKEERERIGITDNLVRFSIGIEDHVDLIDDIKQALDK 385
48478174 313 AHKLIKNLEIPAYAASLGGVESLITMPVETTHASLSPEERRSLGISDSLVRFSTGIEDIDDIIKDFENALSK 384
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap