Conserved Protein Domain Family
PRK06432

?
PRK06432: PRK06432 
NADH dehydrogenase subunit A; Validated
Statistics
?
PSSM-Id: 102372
View PSSM: PRK06432
Aligned: 3 rows
Threshold Bit Score: 210.824
Threshold Setting Gi: 16082575
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
48478472   1 MLSGYIPLAVMLIIIVLVMYLLFIILPAISANRYKpDKRISFKRKDIIENLNIQNNPPASDDSYLHPFESGEVAKEYREG 80 
16082575   8 MLDGYIPLLIIIVVIPLALIFGFKILPALGANRYG-DNTVKLDTETILKKAAYEDTPPGVDQKYLEPYESGEVAREIWGK 86 
13541947   8 MLDGYIPLLIIIVVLPLALIFGFKILPALGANRYG-DNKISLRTEDILKKAAYEDTPPGEDQRYLEPYESGEVAREIWGR 86 
48478472  81 NVTIQYYIIVLLFVLFDIDMLLLLPWAFDFYRLGLLPFIETILFLVMPLFAVYYAFKMGYMRWMK 145
16082575  87 PSINQYYVVVLLFVVFDVDMLLLFPWAVDFKQLGLIKFIETLIFLAMPLFGVYYAFKHGYMRWLK 151
13541947  87 PSINQYYIVVLLFVVFDVDMLLLFPWAYDFKSLGLIPFIETLIFLAMPLFAVYYAFKLGYMRWLK 151
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap