Conserved Protein Domain Family
PRK06425

?
PRK06425: PRK06425 
histidinol-phosphate aminotransferase; Validated
Statistics
?
PSSM-Id: 102370
View PSSM: PRK06425
Aligned: 3 rows
Threshold Bit Score: 445.066
Threshold Setting Gi: 48477885
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16082471   1 MRKHGGDVYAYSGQYEN----ILDFSANTNAFIDTGVLSRYPEVSPGDIEKMILQYTGAKSLR---------VIIGPGLT 67 
13540909   1 MRSHGGDVYKVSPNYDR----ITDMSSNVNPFLDLGKYSLYPEISYTDIEEKLRVYTKSTNMG---------IVIGPGLT 67 
48477885   1 -MGHGGNVLEAASKSGRsirdIIDFSASINDFMEINDIIIK--------KDQIKIYPQGLKIKnkslcefndVLPVPGLT 71 
16082471  68 HFIYRIPAWMGLRRSLIIEPNFNEYEASLLAYGSRTSSLGLGVLKRNPEIVRSYRPDSIFICSPVNPTGDLVDAGLLRKL 147
13540909  68 HLIYKYFEFYQVKKPIIAMPNFSEYKGIAEDRHLRFSAIPSYIIEKDPLILKNFDHDALFITSPSNPFGELFPESTLETV 147
48477885  72 FFIHRLLSYIN-GNIIIVEPTFNEYK-YAFTHGIRIN-LPFNLINNNPEILNNYNFSLIIIVYPDNPLGNLISRDSLLTI 148
16082471 148 SMEMSRMGGILFVDQAFGDFVPEHAEETVRIAEEMGNVIIGRSLTKILSIPSLRLGYILVSDQVFGMIRDREEPWAVCEP 227
13540909 148 FEIEEKRGRRVFLDGAFMDFVPNYAESIVQSSRSYFNVTIGRSLTKILAIPSLRAGYLIMERHEADLFRKAMEPWSICQP 227
48477885 149 SEICRKKSALLFIDESFIFFLKNRYNEDDLLN---GSTIIGRSLTKILGVPSLRIGYIATDDYNMKISKKITGPWSVPDY 225
16082471 228 ALEFVRKADLKALRDTSLKRIGEERSYLMEALENMGFEILGDPHANFIAFRSP---FEIDLKKQLLKSGILIRDLSDYAD 304
13540909 228 AIDFIRSIDINEVAKNSVALVNGEREYLISELKARGIKVIGNPSANYIVISMP---RTDEFYNFMLSKGILVRLLDDYDY 304
48477885 226 VIDYINSIKLDY---HFLDIMENEKSFMINNMEAMGFRAAGDHSANFITFMIPdfiDAHDFYSYLIKNGILVRLLDDYEC 302
16082471 305 FGKNCYRVAVRGRSENALLIQALRNAIL 332
13540909 305 VGRCLVRLAIKTRSQNNAFLNALDNFMS 332
48477885 303 LGEQYIRIGIRRHEFNIKLVNAIRGFLN 330
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap