Conserved Protein Domain Family
PRK06424

?
PRK06424: PRK06424 
transcription factor; Provisional
Statistics
?
PSSM-Id: 102369
View PSSM: PRK06424
Aligned: 3 rows
Threshold Bit Score: 214.806
Threshold Setting Gi: 48478283
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
48478283   1 MECEMCGRNVPQLKRVRVSGAIMNVCPACARFGEPVDEPRK-QEIKEDIKVKIPEKKIIVKTykkPYKKYKRPAGDdvES 79 
16081993   1 MECEMCGKKVSKTTKIMIDGAVLNVCDDCAKFGTPVIEHNKfKPVDQAIKVQLPERPQPRPV---AIKKPAKKVSD--ED 75 
13541924   1 MECEMCGKKTQHTTKVMIDGAILNVCDDCAKFGTPVIEHNNfKRV-ESVKVTLPEPATRVPDthpAKNAVKKKISE--ED 77 
48478283  80 LDIVEDYASLIKSARERLSMTQEDLARKVLERKNVISNIERGDLLPSIETAKKLEKVLGIKLIETE 145
16081993  76 LDIVEDYAELVKNARERLAMSQADLAAKIFERKNVIASIERGDLMPDLKTARKLEKILGITLVEKA 141
13541924  78 LDIVEDYPEIVKNAREKLGMSQADLAARIFERKNVIASIERGDLLPDIKTARKLEKILGITLLEKA 143
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap