Conserved Protein Domain Family
PRK06404

?
PRK06404: PRK06404 
anthranilate synthase component I; Reviewed
Statistics
?
PSSM-Id: 102361
View PSSM: PRK06404
Aligned: 3 rows
Threshold Bit Score: 548.316
Threshold Setting Gi: 48477414
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
13541855   1 MLADQIDEFRTySNFAYFASFPDRvNGYEYVFASDTFQN---DPSKIFDGALRPILVTYDYVNEI--------FDTKVKS 69 
48477414   1 MIYNNIEKFED-KNFAYFCKFNGN-TGQERLFVSDDYNTlykDSEGFLEGEVYDLINKNEFIPACatyslanyFNNIYEK 78 
16082560   2 NLIDELSEYRDrGSLAYFASFPDRiSGYEYAFLGDGMIT---DPERIFDGKLRPLIVTYDFVNSV--------FGQKVRR 70 
13541855  70 SGWPYFLSMDAETIEKRPIMRTSAFKKKNSGSLKDEALEGKIRKIVNLIRNGEVLQVVISREFE-ANVNVNEKIHEFLTK 148
48477414  79 EKYPYFYYMIPERSYKSNIERKSFKTVSLKSNYNDISMSLKIKELIERIRAGELLQVVISREFYlKNIDFKRLLSSFINN 158
16082560  71 SGWPEMVSFDPDTVMKRRIVRSGYLTRKEVGDFSDPDLSRKIAEVRDLIRSGEVLQAVISRDFE-ACIDPWEKLREFIDH 149
13541855 149 DRSRYVFYYRFGKYEVVGSSPENIFTVIGNRIYVDPIAGT-------ISHSFSSDTLYRSEKDRCEHRMLLDLARNDVSK 221
48477414 159 DSSLYVYYYKFGDTRIIGSSPENVFTINNNIINVRPIAGTrrrgsdeYDDKILENELLNNEKEKLEHRMLLDLARNDLGR 238
16082560 150 DRSRYVFYYRIGKYQVVGSSPENLVTVSGNEVFTDPIAGT-------VPSTVRSSVLLESMKDANEHRMLLDLARNDLSK 222
13541855 222 FADIGSLEVPKVMEIEEFSSVKHLVSQVKATfSNKNYVDILRAMFPAGTVTGSPKERAIEIIDKFEETPRGPYGGAVGIV 301
48477414 239 ICEPGTVNVDYSMKIEKFLTVQHMVSSVTGK-TNASLRDIFASVFPAGTVSGAPKKRAMELINKYEDNIRKEYAGAIGII 317
16082560 223 FADIGTLGVSKVMQIEEFSSVKHLVSQVRASfSNTPYLDILKSMFPAGTVSGSPKERAIEIIEKYEETPRGPYGGSIGIT 302
13541855 302 GSGIFDMGLAIRMAYSSGNGFRVRAGAGIVKDSDPSSEVNEIYNKARSVL 351
48477414 318 SKDYTDMALVIRTIFSHDNVVTARAGAGIVKDSIPEDEVNEMFSKAMTVM 367
16082560 303 MDGMMDLALTIRSAYSDGSGFRVRAGAGIVKDSDPDAEVREIYSKARSVI 352
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap