Conserved Protein Domain Family
PRK06397

?
PRK06397: PRK06397 
V-type ATP synthase subunit H; Validated
Statistics
?
PSSM-Id: 135898
View PSSM: PRK06397
Aligned: 3 rows
Threshold Bit Score: 95.3827
Threshold Setting Gi: 48477559
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16082633   1 MELMRMDDVETIRIIKEKETSADEEINQFKEEQEKIIKEAREKEALDLEKTEDELKSRYQEYLESRRKEAEEKASEIIDN 80 
13540886   1 MGWYMMDDIEAIKIIKEKEISSDKEIEDLKKTQDDLVKEASQKNEEEIAKFTEEMEAEYRKFLDEQRKIAEDKAKSIIEE 80 
48477559   1 -----MTELDELKVIKDKEESIKKEIANIINEKENEIKEIKSEYEEKAKSTEEESLNMYNAAIMEARAEEEKRYVELINK 75 
16082633  81 AKQRASAINLDIKEKDLQKMVLEIIMKYLEE 111
13540886  81 ARQKASRILLNISESELTKIVIDTVNAYLEE 111
48477559  76 AKAEADLMKLKLSEDEIREFVINRVIEYLKE 106
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap