Conserved Protein Domain Family
PRK06395

?
PRK06395: PRK06395 
phosphoribosylamine--glycine ligase; Provisional
Statistics
?
PSSM-Id: 102357
View PSSM: PRK06395
Aligned: 3 rows
Threshold Bit Score: 730.166
Threshold Setting Gi: 48478022
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16082534   1 MTEKVMIVGSGGREDAIAMAIKRSGAILFSAIGHENPSIKSLSSKYLVVNELDYRKIEDFAADNLVDMVFIGPDPVLDTP 80 
13541456   1 MVSRVLLIGSGGREDAIARAIKRSGAKLFSVIGHENPSIKRLSEKYLIGDEKDYKSIEDFALSSSVDIVFVGPDPVLETP 80 
48478022   1 --MKIMLVGSGGREDSIARNIALNHE-LYSVLTNENPSIIKNSKKYIFYDKKRHDLIADFALKNNIDIAFVSPDGILANG 77 
16082534  81 LVNNLLRRGIPVASPTMEAARIETSKMFMRELMKRHNIPGNVNFRECFSEEDLESALRDLGPEVAVKPIGLTGGKGVKVV 160
13541456  81 LVNNLLKRGIAVASPTMEAAQIETSKMFMRDLLTRHSIPGNINYKKCFSEQEVKDFFDKNKKDVAVKPIGLTGGKGVKVM 160
48478022  78 LADDLIKNKIKTASPVKSAAMIETSKAYMRYIMEKYNIPGNIE-NATFNNKDAARDYITSMKDVAVKPIGLTGGKGVKVT 156
16082534 161 GEQLETVEDARRYAIEILRRDGVVLIEEKMVGEEFSLQAFVDGKXXSFMPIVQDYKRAYEGDAGPNTGGMGSISDSSFTL 240
13541456 161 GEQLKSQGEAINYAIEVLQRDGVVLIEDRMIGEEFSLQAFTDGKNTSFMPIVQDYKRAFEGDTGPNTGGMGSISDVNFSL 240
48478022 157 GIHLNS-DEAIRYACDIIDRDGQVLIEKKETGEEFSLQAFSDGSHLSFMPVVQDYKRLYEGDHGPNTGGMGSISDRDFSL 235
16082534 241 PFISDRAPEEAKHILVDIIRAMNSENTPFKGIMYGQFMDTPHGVKVIEINARFADPEGINVLTLLKSDFVETLHQIYDGN 320
13541456 241 PFLSKKAPEDARHIINDVVRAMYDENIPFKGVMYGQFMDTPDGVKVIEINARFADPEGINVLSLLKSDFVETLYQIYSGE 320
48478022 236 PFLRKDTPERAKKILNKIIEAMKDENNVFKGIIYGQFMETDNDVKVIEINARFGDPEAINVNYILDDDLGIIFHDILSGN 315
16082534 321 LQGDKIFERKASVLKYIVPIGYGSDPKPGEIELDKAIFDSGVDVLYASVSGDMLRLKQSTSRSLAIIAKGNSIPEASELV 400
13541456 321 LNGERLFEDRATVLKYIVPPGYGQAPLPGDLHIDPEIEKLDTELYYAAVSGTLYDVKMSSSRSLAILGKADNIPEASEMV 400
48478022 316 VNRSIKYMRKATVLKYIVPPGYPENPSKVRIKIDKTL---NSDVYYASVSGTLNDVETLGSRSIAIIARGDSIEDAYLKC 392
16082534 401 DSSLAHVKGSYYVRRDIGRSDFIQSKIRKAKALLG 435
13541456 401 DSALKYVHGSYYVRRDIGKKEFLEKKIMAASRAKS 435
48478022 393 ESDLNAIHGEFYVRHDIGD---IRKKIKN------ 418
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap