Conserved Protein Domain Family
rpoE

?
PRK06393: rpoE 
DNA-directed RNA polymerase subunit E''; Validated
Statistics
?
PSSM-Id: 102355
View PSSM: PRK06393
Aligned: 3 rows
Threshold Bit Score: 127.862
Threshold Setting Gi: 16082113
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16082113  1 MKVQYRACKKCKRLTPEKTCPVHGDEKTTTEWFGFLLITEPELSAIAKRTGITEPGMYAIKVRQ 64 
13541316  1 MKVQYRACKKCKRLTPEKTCPIHPDEKTTTEWFGFLIITEPEFSAIAKRAGISEPGMYAIKVRQ 64 
48477939  1 MKKQYLACKICKRLTTDQFCPVHGDEKTTEEWFGFVIVNDPEGSVIAKRAGITEPGMYAIKVRS 64 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap