Conserved Protein Domain Family
PRK06392

?
PRK06392: PRK06392 
homoserine dehydrogenase; Provisional
Statistics
?
PSSM-Id: 102354
View PSSM: PRK06392
Aligned: 3 rows
Threshold Bit Score: 502.864
Threshold Setting Gi: 16082189
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
48478489   1 MRISIIGLGHIGLSVLDIIKSRNDdyRKNNNGISIVSASDSKlTLYNENGLDPGKIINYKKS-KRLEEIDYEkiKFDEIF 79 
16082189   4 IRIILMGTGNVGLNVLRIIDASNR--RRSAFSIKVVGVSDSR-SYASGRNLDISSIISNKEKtGRISDRAFS--GPEDLM 78 
13541216   4 INLSIFGLGNVGLNLLRIIRSFNEe-NRLGLKFNVVFVADSLhSYYNER-IDIGKVISYKEK-GSLDSLEYEsiSASEAL 80 
48478489  80 EIKPDVIVDVSPATKDGIRGKNLYINAFEHGIDIVTANKAPLALHWHDIMDSASKNRRIIRYEASVGGGVPLFNLRQFCT 159
16082189  79 GEAADLLVDCTPASRDGVREYSLYRMAFESGMNVVTANKSGLANKWHDIMDSANQNSKYIRYEATVAGGVPLFSVLDYSI 158
13541216  81 ARDFDIVVDATPASADGKKELAFYKETFENGKDVVTANKSGLANFWPEIMEYARSNNRRIRYEATVAGGVPLFSFIDYSV 160
48478489 160 MSSRIINFTGLVSSTINYVLNQELSGVGFLDAVKIAQNMGIAETDYSDDTMGLDSARKTVILANSLFNKDITLRDVTYDG 239
16082189 159 LPSKVKRFRGIVSSTINYVIRNMANGRSLRDVVDDAIKKGIAESNPQDDLNGLDAARKSVILVNHIFGTEYTLNDVEYSG 238
13541216 161 LPSRIKKFRGIVSLTINYFIRELANKREFDDVLSEATKLGIVEKNYKDDLTGLDAARKSVILCNHLYGSSYRLSDVFYEG 240
48478489 240 IEniDISSMDNEKVYRVVAMIenNGGFHAESKIRAFSRNDFLGMISPLSMAYSMETDINDNINIFENHDGPLQTAAQVVN 319
16082189 239 VD--ERSYNANDRLVTEVYVD--DRRPVAVSRIISLNKDDFLMSIGMDGLGYQIETDSNGTVNVSDIYDGPYETAGAVVN 314
13541216 241 ILdqDRSFGKNERLVTETGIV--NGKPSAESRIKSLDSNDYLLTLGKGSLGYQLQTDTNGTLNVSDLYDGPYETAGAVMN 318
48478489 320 DVMLL-KYKI 328
16082189 315 DILLLsKVQK 324
13541216 319 DLVILsMFTV 328
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap