Conserved Protein Domain Family
PRK06388

?
PRK06388: PRK06388 
amidophosphoribosyltransferase; Provisional
Statistics
?
PSSM-Id: 102351
View PSSM: PRK06388
Aligned: 3 rows
Threshold Bit Score: 827.247
Threshold Setting Gi: 48477741
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16082247   1 MDSLPPGSDPIDGQKPSEDCAVVGFKGRINAYEPIITALRTLQHRGQESAGMAVFDGRKTVLKKGRGLVTDVFNPATDSI 80 
13541185   1 MDSRPQGSDPINGQKPSEDCAVVGFKGKINAYNPIITALRTLQHRGQESAGMAVFDGKKVTLKKGSGLVTDVFNPATDDI 80 
48477741   1 MDSQPQESDITTGQKVNEDCAVIGFSGG-GVYSSIIAGLRSLQHRGQESSGIITYDG-KIHVKKGMGLVSEVFKNA-DPM 77 
16082247  81 KGKVGVGHTRYSTAGSKDVIDAGPFVINSQVGFISLSHNGEIVNADELKEEMKKEGVNFQSDSDTEVLLAELSRNISKYG 160
13541185  81 KGYVGVGHTRYSTAGSKNVVNAGPFVMNSSFGYITISHNGEIVNADELRDSMKKEGITFQSDSDTEVMLAELSRNISKYG 160
48477741  78 PGIVGIGHNRYSTSGSKGIENAGPFVISCSLGYIGITHNGEITNEHELREELKHDGYIFTSSSDTEVMLIEFVKEISRYG 157
16082247 161 LKKGFEVSMNTLRGAYACAVGINDRLFAMRDPNGIRPLIVGKNADGYIIASESCAIDALDGTIIRNVEPGEVVELTDDGL 240
13541185 161 LKRGFEQSMESLRGAYACAISINDRLYAVRDPNGIRPLVIGKNNDGYIVASESCAIDALEGTLIKNIEPGEVVEISDEGI 240
48477741 158 INEGIKRGMERLKGAYAAVLMINDRLYAIRDKFGFRPLVLGRTFNGYIIASETCAIDALSGETIKNVEPGEVIEVFNNSY 237
16082247 241 KTIALHEGEKTAHCMFEYVYFSRPDSTIDGINVYMARVKMGMMLAKESPVEADMVIPVPDSGRSQAIGFSMQSGIPYTEG 320
13541185 241 RTIVSKSANRIAHCMFEYVYFSRPDSVIDGINVYAARVNMGRILAKESPVEADIVVPVPDSGRSQAIGYSMESGMPYTEG 320
48477741 238 KTIFKLDGD-VSHCMFEYVYFARPDSIIDNIEVFQARVRMGMRLAVESPVDADVVVPVPDSGRAQALGFSKATGIPYSEG 316
16082247 321 LMKNRYSERTFIMPTQSDRKAAIRLKLNPVREVISGKRIVLVDDSIVRGNTMRFIVSMMRKYGAKEVHVRIGSPHIIAPC 400
13541185 321 LIKNRYSERTFIMPTQSDRKAAIHLKLNPIREVIGGKKVVLVDDSIVRGNTMRFIVGLMRKYGAKEIHVRIGSPHIIAPC 400
48477741 317 LIKNRYSERTFIMPDQKSRLAAIKIKLNAIKSEISNKRIVLVDDSIVRGNTMKYIVKIVRDAGASEVHVRISSPPITAPC 396
16082247 401 YFGVDMKTKDQFIARGKTDAEINSEIGADSLAFLSIDGLKEAIGLDENNLCLGCLTGTYPIDISKKLAEKITQY 474
13541185 401 YFGVDMKTKDQFIARGKTDEEINREIGADSLAFLSVDGLKQAISMKNNNLCLGCLTGEYPIDISKKLAENITSY 474
48477741 397 FYGVDMKTKNEFIAANKTIESIKNEIGADSLAYLSIDGLKQAIGIK--SICISCLTGIYPEYVPLS-------- 460
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap