Conserved Protein Domain Family
PRK06234

?
PRK06234: PRK06234 
methionine gamma-lyase; Provisional
Statistics
?
PSSM-Id: 168478
View PSSM: PRK06234
Aligned: 13 rows
Threshold Bit Score: 776.697
Threshold Setting Gi: 19704751
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
170756985   1 MENIKKMGFATKAIHGGHIgDKQFGSLATPIYQTSTFIFDSAEQGGRRFAGEESGYIYSRLGNPTSTEVENKLALLECGE 80 
42527703    3 RKELEKLGFASKQIHAGSI-KNKYGALATPIYQTSTFAFDSAEQGGRRFALEEEGYIYTRLGNPTTTVVEEKLACLENGE 81 
34540176    1 ----MRSGFATRAIHGGAI-ENAFGCLATPIYQTSTFVFDTAEQGGRRFAGEEDGYIYTRLGNPNCTQVEEKLAMLEGGE 75 
188995482   3 KEDLMRSGFATRAIHGGAI-ENAFGCLATPIYQTSTFVFDTAEQGGRRFAGEEDGYIYTRLGNPNCTQVEEKLAMLEGGE 81 
19704751    1 -MEMKKSGLGTTAIHAGTL-KNLYGTLAMPIYQTSTFIFDSAEQGGRRFALEEAGYIYTRLGNPTTTVLENKIAALEEGE 78 
28212109    1 -MDIKNMGFGTKAIHGGNKkDTQYGALSTPIYQTSTFIFDSAEQGGKRFAGEESGHIYTRLGNPTTGQLEDKMAILEGGE 79 
118443737   4 EHNLSNMGFGTKTVHGGHIkDTQFGSLATPIFQTSTFIFDSAEQGGNRFAGKEDGYIYSRIANPTVAEIERKIALLEGGE 83 
148378036   1 MENIKKMGFATKAIHGGHIgDKQFGSLATPIYQTSTFIFDSAEQGGRRFAGEESGYIYSRLGNPTSTEVENKLALLECGE 80 
153931933   1 MENIKKMGFATKAIHGGHIgDKQFGSLATPIYQTSTFIFDSAEQGGRRFAGEESGYIYSRLGNPTSTEVENKLALLECGE 80 
153937734   1 MENIKKMGFATKAIHGGHIgDKQFGSLATPIYQTSTFIFDSAEQGGRRFAGEESGYIYSRLGNPTSTEVENKLALLECGE 80 
170759255   1 MENIKKMGFATKAIHGGHMgDKQFGSLATPIYQTSTFIFDSAEQGGRRFAGEESGYIYSRLGNPTSTEVENKLALLEGGE 80 
226947242   1 MENIKKMGFATKAIHGGHIgDKQFGSLVTPIYQTSTFIFDSAEQGGRRFAGEESGYIYSRLGNPTSTEVENKLALLECGE 80 
153939022   1 MENIKKMGFATKAIHGGHIgDKQFGSLATPIYQTSTFIFDSAEQGGRRFAGEESGYIYSRLGNPTSTEVENKLALLECGE 80 
170756985  81 AAVVAASGMGAIAASLWSALKSGDHVVASDTLYGCTFALLNHGLTRYGVEVTFVDVSNLDEVRNALKANTKVVYLETPAN 160
42527703   82 ACMSASSGIGAVTSCIWSIVNAGDHIVAGKTLYGCTFAFLNHGLSRFGVDVTFVDTRDPENVKKALKPNTKIVYLETPAN 161
34540176   76 AAASASSGIGAISSAIWVCVKAGDHIVAGKTLYGCTFAFLTHGLSRYGVEVTLVDTRHPEEVEAAIRPNTKLVYLETPAN 155
188995482  82 AAASASSGIGAISSAIWVCVKAGDHIVAGKTLYGCTFAFLTHGLSRYGVEVTLVDTRHPEEVEAAIRPNTKLVYLETPAN 161
19704751   79 AGIAMSSGMGAISSTLWTVLKAGDHVVTDKTLYGCTFALMNHGLTRFGVEVTFVDTSNLEEVKNAMKKNTRVVYLETPAN 158
28212109   80 AVIATASGMGAISSALWTALKAGDHVVAGETLYGCTFALLCHGLPRFGVEVTFVDTTNLEEVEKAIKENTKVVYLETPAN 159
118443737  84 AAIGTASGMGAISSALWTALKAGDHVVASDTLYGCTFALLNHGLTKMGVEVTFVDPTNLEEVKNAMKENTRVVYLETPAN 163
148378036  81 AAVVAASGMGAIAASLWSALKSGDHVVASDTLYGCTFALLNHGLTRYGVEVTFVDVSNLDEVRNALKANTKVVYLETPAN 160
153931933  81 AAVVAASGMGAIAASLWSALKSGDHVVASDTLYGCTFALLNHGLTRYGVEVTFVDVSNLDEVRNALKANTKVVYLETPAN 160
153937734  81 AAVVAASGMGAIAASLWSALKSGDHVVASDTLYGCTFALLNHGLTRYGVEVTFVDVSNLDEVRNALKANTKVVYLETPAN 160
170759255  81 AAVVAASGMGAIAASLWSALKSGDHVVASDTLYGCTFALLNHGLTRYGVEVTFVDVSNLDEVRNALKANTKVVYLETPAN 160
226947242  81 AAVVAASGMGAIAASLWSALKSGDHVVASDTLYGCTFALLNHGLTRYGVEVTFVDVSNLDEVRNALKANTKVVYLETPAN 160
153939022  81 AAVVAASGMGAIAASLWSALKSGDHVVASDTLYGCTFALLNHGLTRYGVEVTFVDVSNLDEVRNALKANTKVVYLETPAN 160
170756985 161 PTLKVTDIKQISNMVHENNKECLVFVDNTFCTPYIQRPLQLGADVVVHSATKYLNGHGDVIAGFAVGKEEFINQVKLFGI 240
42527703  162 PNMYLCDIAAVSKIAHAHNPECKVIVDNTYMTPYLQRPLDLGADVVLHSATKYLNGHGDVIAGFVVGKKEFIDQVRFVGV 241
34540176  156 PNMYLTDIKAVCDIAHK-HEGVRVMVDNTYCTPYICRPLELGADIVVHSATKYLNGHGDVIAGFVVGKEDYIKEVKLVGV 234
188995482 162 PNMYLTDIKAVCDIAHK-HEGVRVMVDNTYCTPYICRPLELGADIVVHSATKYLNGHGDVIAGFVVGKEDYIKEVKLVGV 240
19704751  159 PNLKIVDLEALSKIAHT-NPNTLVIVDNTFATPYMQKPLKLGVDIVVHSATKYLNGHGDVIAGLVVTRQELADQIRFVGL 237
28212109  160 PNLKVADIKAISEIAHK-KEDCMVFVDNTFCTPCIQRPLELGADVVVHSATKYLNGHGDVLAGFVVGKQEFINNVRGFGV 238
118443737 164 PTLKVTDIEGIAKIAHE-VKDCLVFVDNTFNTPYIQRPLELGADVVVHSATKYINGHGDVVAGFVIGNADFIGAVRGQGL 242
148378036 161 PTLKVTDIKQISNMVHENNKECLVFVDNTFCTPYIQRPLQLGADVVVHSATKYLNGHGDVIAGFAVGKEEFINQVKLFGI 240
153931933 161 PTLKVTDIKQISNMVHENNKECLVFVDNTFCTPYIQRPLQLGADVVVHSATKYLNGHGDVIAGFAVGKEEFINQVKLFGI 240
153937734 161 PTLKVTDIKQISNMVHENNKECLVFVDNTFCTPYIQRPLQLGADVVVHSATKYLNGHGDVIAGFAVGKEEFINQVKLFGI 240
170759255 161 PTLKVTDIKQISNMVHENNKECLVFVDNTFCTPYIQRPLQLGADVVVHSATKYLNGHGDVIAGFAVGKEEFINQVKLFGI 240
226947242 161 PTLKVTDIKQISNMVHENNKECLVFVDNTFCTPYIQRPLQLGADVVVHSATKYLNGHGDVIAGFAVGKEEFINQVKLFGI 240
153939022 161 PTLKVTDIKQISNMVHENNKECLVFVDNTFCTPYIQRPLQLGADVVVHSATKYLNGHGDVIAGFAVGKEEFINQVKLFGI 240
170756985 241 KDMTGSVIGPFEAFLIIRGMKTLQLRMEKHCKNAMEVAKFLESHPAVKKVYYPGLESFEYYELAKKQMSLPGAMISFELK 320
42527703  242 KDMTGSTLGPFEAYLIGRGMKTLDIRMEKHCANAQKVAEFLEKHPAVESIAFPGLKSFPQYELAKKQMKLCGAMIAFTVK 321
34540176  235 KDLTGANMSPFDAYLISRGMKTLQIRMEQHCRNAQTVAEFLEKHPAVEAVYFPGLPSFPQYELAKKQMALPGAMIAFEVK 314
188995482 241 KDLTGANMSPFDAYLISRGMKTLQIRMEQHCRNAQTVAEFLEKHPAVEAVYFPGLPSFPQYELAKKQMALPGAMIAFEVK 320
19704751  238 KDMTGAVLGPQEAYYIIRGLKTFEIRMERHCKNARTIVDFLNKHPKVEKVYYPGLETHPGYEIAKKQMKDFGAMISFELK 317
28212109  239 KDMTGSVLSPFDAFLVLRGLKTLEIRMERHCANAQKVAEFLQGHEAVSKVYYPGLNDSEYYDIAKKQMRMPGAMISFEVN 318
118443737 243 KDMTGAVMSPLSAFLIIRGMKTLEIRMERHCANAMKVAQFLEAHPAVEKVYYPGLESFEYHDLAKKQMDLPGAMISFEIK 322
148378036 241 KDMTGSVIGPFEAFLIIRGMKTLQLRMEKHCKNAMEVAKFLESHPAVKKVYYPGLESFEYYELAKKQMSLPGAMISFELK 320
153931933 241 KDMTGSVIGPFEAFLIIRGMKTLQLRMEKHCKNAMEVAKFLESHPAVKKVYYPGLESFEYYELAKKQMSLPGAMISFELK 320
153937734 241 KDMTGSVIGPFEAFLIIRGMKTLQLRMEKHCKNAMEVAKFLESHPAVKKVYYPGLESFEYYELAKKQMSLPGAMISFELK 320
170759255 241 KDMTGSVIGPFEAFLIIRGMKTLQLRMEKHCKNAMEVAKFLESHPAVKKVYYPGLESFEYYELAKKQMSLPGAMISFELK 320
226947242 241 KDMTGSVIGPFEAFLIIRGMKTLQLRMEKHCKNAMKVAKFLESHPAVKKVYYPGLESFEYYELAKKQMSLPGAMISFELK 320
153939022 241 KDMTGSVIGPFEAFLIIRGMKTLQLRMEKHCKNAMEVAKFLESHPAVKKVYYPGLESFEYYELAKKQMSLPGAMISFELK 320
170756985 321 GGVEEGKVVMNNVKLATLAVSLGDAETLIQHPASMTHSPYTAEERKEAGISDGLVRLSVGLEDVDDIISDLKQALDLIVK 400
42527703  322 GGLEAGKTLINSVKFATIAVSLGDAETLIQHPASMTHSPYTPEERAASDIAEGLVRLSVGLEDAEDIIADLKQALDKLVK 401
34540176  315 GGCEAGKKLMNNLHLCSLAVSLGDTETLIQHPASMTHSPYTPEERAASDISEGLVRLSVGLENVEDIIADLKHGLDSLI- 393
188995482 321 GGCEAGKKLMNNLHLCSLAVSLGDTETLIQHPASMTHSPYTPEERAASDISEGLVRLSVGLENVEDIIADLKHGLDSLI- 399
19704751  318 GGFEAGKTLLNNLKLCSLAVSLGDTETLIQHPASMTHSPYTKEEREVAGITDGLVRLSVGLENVEDIIADLEQGLEKI-- 395
28212109  319 GGLEEGKKIMDSVKLANLAVSLGDAETLIQHPASMTHSPYTKEEREAAGISDNLVRLSVGLENVEDIIEDLRQALDTIKK 398
118443737 323 GGVEEGRTIMNNVKLASLAVSLGDTETLIQHPASMTHSPYTKEERAEAGISDSLVRLSVGLETVDDIIADLKQALDLIVK 402
148378036 321 GGVEEGKVVMNNVKLATLAVSLGDAETLIQHPASMTHSPYTAEERKEAGISDGLVRLSVGLEDVDDIISDLKQALDLIVK 400
153931933 321 GGVEEGKVVMNNVKLATLAVSLGDAETLIQHPASMTHSPYTAEERKEAGISDGLVRLSVGLEDVDDIISDLKQALDLIVK 400
153937734 321 GGVEEGKVVMNNVKLATLAVSLGDAETLIQHPASMTHSPYTAEERKEAGISDGLVRLSVGLEDVDDIISDLKQALDLIVK 400
170759255 321 GGVEEGKVVMNNVKLATLAVSLGDAETLIQHPASMTHSPYTAEERKEAGISDGLVRLSVGLEDVDDIISDLKQSLDLIVK 400
226947242 321 GGVEEGKVVMNNVKLATLAVSLGDAETLIQHPASMTHSPYTAEERKEAGISDGLVRLSIGLEDVDDIISDLKQALDLIVK 400
153939022 321 GGVEEGKVVMNNVKLATLAVSLGDAETLIQHPASMTHSPYTAEERKEAGISDGLVRLSVGLEDVDDIISDLKQALDLIVK 400
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap