Conserved Protein Domain Family
PRK06217

?
PRK06217: PRK06217 
hypothetical protein; Validated
Statistics
?
PSSM-Id: 168472
View PSSM: PRK06217
Aligned: 15 rows
Threshold Bit Score: 251.123
Threshold Setting Gi: 152982410
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148253893   3 SCRIHITGASGSGTTTLGRAVASALAVPHHDTDDYIWVPTEPPYAELRPAAERLRLMMAMFLPRGRWVLSGSLQGWGDPL 82 
146300992   1 -MKIHIFGASGSGVTTTGNALAEKLAYRYFDSDDYFWEKSDVPFTLRRNPEERNSKIKSDLENSENWILGGSIFQWGENV 79 
86359401    1 MVHIHVMGASGSGTTSLGRALAEKLDIAHLDTDDFFWLPTDPPFTTPRDADERIRLLLEETRRPGGWILSGSALKWGRPL 80 
190893656   1 MVHIHVMGASGSGTTSLGRALADRLDIAHLDTDDFFWLPTDPPFTTPRDSDERIRLLLEATRRPGGWIVSGSALKWGRPL 80 
91777013    5 PTRIYITGASCAGVTTLGAMLSRQLDLPHIDVDQFYWLPTNPPFSLKRPPQERVSLIREAL-GTEGWILSGSFDGWGDVL 83 
83594363    4 RSRLYLTGASCSGVSTLGAALSQRLNLPHLDVDDFYWMPTDPPFSTKRPPEDRVRLIGKRQRDSEGWILTGSFLGWGDAL 83 
15805998   14 PRRLHVLGASGAGTTTLGRDLAAALQLGHFETDDFFWAPSDPPYHVKRAPEQRLSLLREALVDGDGWVLSGSLCGWGDPL 93 
154686842   1 MNNIHILGASGVGTSTLGVALSKHLPHMHLDTDDYYWTDK---FTKKREIPERRKLLEKDLTINEKWILSGAVCGWGDDL 77 
152982410   1 -MHILITGAAGSGTSTFAAALAEATHATFIETDDYFWLPSDPPYQHKRAEAERGNVLLQDIRSKPDAVVAGSLIDWGQEL 79 
256377668   3 TRRLLVTGASGAGTTTLGRVLAARWHVPHADLDDYFWLPTDPPYTDKRPEAERLRLMGEVFLPRPAWVMSGAPMGWGESL 82 
148253893  83 IAHFDLVVFITIAKELRLQRLRVREVTRYGAEaVAPGGARHRETEEFVAWAAAYDEADIGt-SRTLAKHETWLSDLPCPV 161
146300992  80 FPDFDLVVYLWIPPQIRMERLKKREFERYGNV-IYTNPDRIKQFEDFMEWAADYDNNTGIa-SRNFQAHENWLNSIDFPV 157
86359401   81 ERLYDLIVFVRIEPELRMARIRAREATRYGHR-IGPGGDMEVKSGEFLEWAASYDTAGPE--RRSLAAHEEWLETQTVPV 157
190893656  81 EPLYDLIVFLTIQPELRMARIRAREAARYGQR-IGPGGDMEVKSGEFLAWAASYDTAGPE--RRSLAAHEQWLETQTAPV 157
91777013   84 IEHASLIVFIVTPHAVRMDRLKNREKQRYGNR-IALGGDMHEAHLAFTEWASQYESPGPShtGRNLARHESWLAKQSLPV 162
83594363   84 IETVDLIVFLYTPPAIRLQRLDHREATRYGER-ILPGGDMHKAHLAFRAWASRYDDPSFT--GRTLEQHELWLSAQTAPV 160
15805998   94 MAEFDAVIFVTLPTPLRLERTRQRERARFGAQ-LDEGGAMHRRQLDFMAWSAGDDDPASSv-GRSRLVHEAWLARLSCPV 171
154686842  78 KSYFDLVIFLWIPQDIRLERLRHREFQRYGNE-VLAGGSKYEQSKTFLEWASLYDNAGME--VRSKALHENWMADLSCPL 154
152982410  80 EDAFDLVVFLYIPTELRLARLKLREERRFG-----------KADPEFLAWAAQYDEGTAE--GRSLERHRQWLSARKCTV 146
256377668  83 VPLLDAVVLLTLAPDVRLRRITDREGERRLAP-LEPGGPDEAAFHDFLDWARGYDDPEFD--GRSLARHERWLAGMSCPV 159
148253893 162 LRLDGAKPLEELTAQVLSSTSRAPRV 187
146300992 158 LKISGDLTLQQRIDLIIENINKKPLH 183
86359401  158 LRLDSSRDIDNLLTEVLLHPAIAAGA 183
190893656 158 LRLDSSRDIDDLLAEVLLHPAIAAGA 183
91777013  163 LRLDGTASPDRMAEQVLSALFQTRYG 188
83594363  161 LRLQGERPTGDLAQCVAEALPRL--- 183
15805998  172 VRVDNAGTQADTLGEVLARLSALP-- 195
154686842 155 LKIEGDYSVNERVDRVLDYLNSN--- 177
152982410 147 LCLEGDLTTEERMQRVLALRHSHDYN 172
256377668 160 LRLDSASPVEALADAVDDLLA----- 180
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap