Conserved Protein Domain Family
PRK06145

?
PRK06145: PRK06145 
acyl-CoA synthetase; Validated
Statistics
?
PSSM-Id: 102207
View PSSM: PRK06145
Aligned: 4 rows
Threshold Bit Score: 934.303
Threshold Setting Gi: 27378293
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
33603673   1 MFNLSASIAFHARRTPDKAAIVYRDQEIGYAEFHQRILQAAAMLHARGISQNDVVALFMKNSAAFLELAFAASYLGAVFL 80 
27378293   1 MINLSSFIAFHARRTPERPALKYRGEEISYAVFDARIRKAAGWLAAQGIGAGDVVAVLMKNSAAFLELVFATSHLGAVFL 80 
33591821   1 MFNLSASIAFHARRTPDKAAIVYRDQEIGYAEFHQRILQAAAMLHARGIGQNDVVALFMKNSAAFLELAFAASYLGAVFL 80 
91780873   1 MVSLSDSVAWWARTNPSRTALMYGNQSISYGDLQRRVEATAGMLKGTRIRRGDIVALLMKNSAAFVEIMLAVSQAGAVIL 80 
33603673  81 PVNYRLAAPEAAYILGDAGAKLLLVDEEFDAIVAlETPKIVIDAHAQADSRRLGqPGLEIPPQAAVAETDLVRLMYTSGT 160
27378293  81 PINFRLSRDEVGYIAGNAGARLLMVDEELAANAA-GAKIVVLDEAAQQSVTRLA-GGAAAAPMHVRAPSDLMRLMYTSGT 158
33591821  81 PVNYRLAAPEAAYILGDAGAKLLLVDEEFDAIVAlETPKIVIDAQAQADSRRLGqPGLEIPPQAAVAETDLVRLMYTSGT 160
91780873  81 PINYRLGPDEVAYILQHSGAKLLFHDEEFEVPPGlVHSQAVTGA-AQSDTSVLAaGHEPCTEAYPSRPDDLYRLMYTSGT 159
33603673 161 TSRPKGVMHSYGNLHWKSIDHVIALGLTASEKLLVVGPLYHVGAFDLPGIAVLWVGGTLCVHREFDPEAVLASIERHRLT 240
27378293 159 TDRPKGVMLSYDNFYWKSADQTIALGLSAETRLLVVGPLYHVGALDLPGIAVLWHGGFIRIERNFEPETALAAIAEDRLN 238
33591821 161 TSRPKGVMHSYGNLHWKSIDHVIALGLTASEKLLVVGPLYHVGAFDLPGIAVLWVGGTLCVHREFDPEAVLASIERHRLT 240
91780873 160 TDRPKGVMHSYGNVAWKSFDHIAALGITKDDRLLVVGPLYHVGACDLPGLAVLAQGGMLRIMRDFDAQAVLEAIERERLT 239
33603673 241 CGWMAPVMLSRVLTVPDPDRFDLDTFAWCIAGGEKTPESRIRDFTRVFTRGRFVDGFGMTETCSGDTLMEAGREIEKIGS 320
27378293 239 AAWFAPVMTTAMLTCPTRDRYDVSSLTWAIGGGEKTPELRIRAFSEYFRNARYIDAYGLTETVGGDTFMEAGREIEKIGS 318
33591821 241 CGWMAPVMLSRVLTVPDPDRFDLDTFAWCIAGGEKTPESRIRDFTRVFTRGRFVDGFGMTETCSGDTLMEAGREIEKIGS 320
91780873 240 GAWLAPVMLSRILALPERYRFDLGSLRWVVGGGERTPEQRIREFGSLFTGARYIDAYGLTESCSGDTLMEQGRELDKIGS 319
33603673 321 TGRALPHVEIRIADGAGGWLPANQKGEICMRGPKVTKGYWNAPEKTAEAFYGDWLRSGDVGYLDEEGFLFVTDRTKDMIL 400
27378293 319 TGRAIAHVEIEIRDEEGRTLPPNVNGEICLCGPKITRGYWKDSEKTAAAFFGDWFRSGDVGYLDDEGFLYLTDRKKDMII 398
33591821 321 TGRALPHVEIRIADGAGGWLPANRKGEICMRGPKVTKGYWNAPEKTAEAFYGDWLRSGDVGYLDEEGFLFVTDRTKDMIL 400
91780873 320 TGRALAHVQLAIMSDDGRMLAPGMQGEICVRGPKVTQGYWKDPEKTARSFVDGWFRTGDVGYMDEEGFLYLTDRKKDMII 399
33603673 401 TGAENVASSEVEAALYELPQIAEAAVIGVHDDKWGERITAVVVLNPGQTLTLEEIDRHCRQRLASFKVPRELKVVAELPR 480
27378293 399 SGGENIASSEVERVIYELSEVREVAVIGLRDARWGERPVAIVVLAEGASLELPALTEHCRARLASFKVPKQLVVRDSLPR 478
33591821 401 TGAENVASSEVEAALYELPQIAEAAVIGVHDDKWGERITAVVVLNPGQTLTLEEIDRHCRQRLASFKVPRELKVVAELPR 480
91780873 400 SGGENIASSEVERVIYQLAEVAEAAVIGAPDPRWGEQVTAVVVLRAGATLTLDALRTHCEGRLGGFKTPRQLILRDALPR 479
33603673 481 NPSGKVLKRVLRDEY------NG 497
27378293 479 NPSGKILKRVLRAEL------ET 495
33591821 481 NPSGKVLKRVLRDEY------NG 497
91780873 480 NPSGKVLKRVLRDELlkesdhDG 502
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap