Conserved Protein Domain Family
PRK06113

?
PRK06113: PRK06113 
7-alpha-hydroxysteroid dehydrogenase; Validated
Statistics
?
PSSM-Id: 135765
View PSSM: PRK06113
Aligned: 46 rows
Threshold Bit Score: 455.461
Threshold Setting Gi: 225853087
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
82700418    1 MSYESPFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAAAIRQAGGKAIGLECNVTDEQHREAVIK 80 
148560168   1 MSYESPFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAAAIRQAGGKAIGLECNVTDEQHREAVIK 80 
23502481    1 MSYESPFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAAAIRQAGGKAIGLECNVTDEQHREAVIK 80 
62290495    1 MSYESPFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAAAIRQAGGKAIGLECNVTDEQHREAVIK 80 
161619557   1 MSYESPFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAAAIRQAGGKAIGLECNVTDEQHREAVIK 80 
256370032   1 MSYESPFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAAAIRQAGGKAIGLECNVTDEQHREAVIK 80 
161511159   1 MSYESPFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAAAIRQAGGKAIGLECNVTDEQHREAVIK 80 
225853087   1 MSYESPFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAAAIRQAGGKAIGLECNVTDEQHREAVIK 80 
163843867   1 MSYESPFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAAAIRQAGGKAIGLECNVTDEQHREAVIK 80 
172037506   1 MSVLDSFKLDDHVAIITGAGAGIGRGIAELFAQAGAAVVVSDLKLETAEIVAEKIKSQGGKAIAVSCDVTTNEALENLVN 80 
82700418   81 AALDQFGKITVLVNNAGGGGPKPFDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRMASYG 160
148560168  81 AALDQFGKITVLVNNAGGGGPKPFDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRMASYG 160
23502481   81 AALDQFGKITVLVNNAGGGGPKPFDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRMASYG 160
62290495   81 AALDQFGKITVLVNNAGGGGPKPFDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRMASYG 160
161619557  81 AALDQFGKITVLVNNAGGGGPKPFDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRMASYG 160
256370032  81 AALDQFGKITVLVNNAGGGGPKPFDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRMASYG 160
161511159  81 AALDQFGKITVLVNNAGGGGPKPFDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRMASYG 160
225853087  81 AALDQFGKITVLVNNAGGGGPKPFDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRMASYG 160
163843867  81 AALDQFGKITVLVNNAGGGGPKPFDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRMASYG 160
172037506  81 STLTAFGKITILVNNAGGGGPKPFDMPMDTFIWAYQLNVFSLFHLCQLCVPHIEAAGGGSILNISSMSGDNKNSNMASYG 160
82700418  161 SSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATVLTPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWIS 240
148560168 161 SSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATVLTPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWIS 240
23502481  161 SSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATVLTPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWIS 240
62290495  161 SSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATVLTPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWIS 240
161619557 161 SSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATVLTPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWIS 240
256370032 161 SSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATVLTPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWIS 240
161511159 161 SSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATVLTPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWIS 240
225853087 161 SSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATVLTPEIERAILKHTPLGRLGEAQDIANAALFLCSPAAAWIS 240
163843867 161 SSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATVLTPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWIS 240
172037506 161 SSKAAVSHLTRNIAFDLGPKNIRVNAIAPGAIKTDALASVLTPDIETAMLKHTPLARLGNPKDIAYAALFLCSPAASWIS 240
82700418  241 GQVLTVSGGGVQELD 255
148560168 241 GQVLTVSGGGVQELD 255
23502481  241 GQVLTVSGGGVQELD 255
62290495  241 GQVLTVSGGGVQELD 255
161619557 241 GQVLTVSGGGVQELD 255
256370032 241 GQVLTVSGGGVQELD 255
161511159 241 GQVLTVSGGGVQELD 255
225853087 241 GQVLTVSGGGVQELD 255
163843867 241 GQVLTVSGGGVQELD 255
172037506 241 GQVLTVSGGGVQELD 255
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap