Conserved Protein Domain Family
PRK06023

?
PRK06023: PRK06023 
crotonase/enoyl-CoA hydratase family protein
Statistics
?
PSSM-Id: 168351
View PSSM: PRK06023
Aligned: 23 rows
Threshold Bit Score: 416.886
Threshold Setting Gi: 15964629
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
159184444   2 SDDHILVEPVGHapeVVTIRFNRPEKKNAITDAMYLRMAEALHAANANTEIRVVAFLGTEGCFSAGNDMADFLAFAMSGG 81 
222085091   1 MTDHILIQRPETaphVQVIRFNRPEKKNAITRVMYQTMTDALQAANEDPDIRVTAFLGTEGCFSAGNDMGDFLAFAMGG- 79 
222147746   1 MSEHILVERPEThpgVLVIRFNRPDKKNAITEAMYHRITAALNEAQGDDTVRVVAFLGTEGCFTAGNDMGDFLAYALSDG 80 
227821070   1 MTDHVLVERPEAypgVQVIRFNRPEKKNAFTREMYAKMTNALTVAVSDPAIRATAFLGTDGCFSAGNDMNDFLAFAMGG- 79 
241203348   1 MTDHIIVEQPSAhpgVQSIRFNRPEKKNAITRAMYRTMADALNAANTNPGIRATALLGTEGCFSAGNDMNDFLAAAMGGR 80 
209548162   1 MTDHIIVEQPSAhpgVQLIRFNRPEKKNAITRAMYRTMADALKAADADTTIRATAFLGTEGCFSSGNDLNDFLAAAVGGG 80 
116250740   1 MTDHIIVEQPSAypgVQSIRFNRPEKKNAITRAMYRTMADALNAANTSPNIRATAFLGTEGCFSAGNDLNDFLAAAMGGR 80 
86356552    1 MTDHIIVEQPSAhpgVQVIRFNRPEKKNAFTRAMYRTMTDALTAANTDANLRVTVFLGTEGSFSAGNDIGDFLATAMGG- 79 
150395713   1 MTDHVLVERPEAypgVQLIRFNRPEKKNAITREMYAKMTEALTAAGADPAIRATAFLGTQGCFSAGNDMSDFLAFAMGG- 79 
15964629    1 MTDHVLVERPDAypgVQLIRFNRPEKKNAITRQMYARMTEALTAAGTDPAIRAMAFLGTEGCFSAGNDMADFLAFAMGG- 79 
159184444  82 KGKLAALEFLKALVAFEKPLVSGVDGLAIGIGTTLNLHCDLTVASSRSLFKTPFVDLALVPEAASSLLVPKLIGHQRAFA 161
222085091  80 SMGREVLDFLGALATAKKPIVSGVDGLAIGIGTTIHMHCDLTVASDRSLFKTPFVDLALVPEAASSLLAPRLMGHQRAFA 159
222147746  81 SKLPAAALVLRALVAAEKPLVSGVDGLAIGIGTTLNMHCDLTIASSRSLFKTPFVDLALVPEAASSLLAPLAMGHQRAFA 160
227821070  80 SMGGEVLDFLRALASATKPVVSGVDGLAIGIGTTIHLHCDLTVASARSVFKTPFVDLALVPEAASSLLAPRIMGHQRAFA 159
241203348  81 GLEQEILDFLYALVNAEKPVVSGVDGLAIGIGTTIHLHCDLTIASSRSQFRTPFVDLALVPEAGSSLVAPRLMGHQRAFA 160
209548162  81 GLEQEILDFLYALVKAEKPVISGVDGLAIGIGTTIHLHCDLTIASSRSQFRTPFVDLALVPEAGSSLVAPRLMGQQRAFA 160
116250740  81 GLEQEILDFLYALVNSEKPVVSGVDGLAVGIGTTIHLHCDLTIASSRSQFRTPFVDLALVPEAGSSLLAPRLMGHQRAFA 160
86356552   80 SMGDELIDFLYALAKSEKPLVSGVDGLAIGIGTTLNLHCDLTIASDRSQFRTPFVDLALVPEAASSLIAPRIMGHQRAFA 159
150395713  80 SMGGEVLDFLRALAGATKPVVSGVDGLAIGIGTTIHLHCDLTVSSARSVFKTPFVDLALVPEAASSLIAPRIMGHQRAFA 159
15964629   80 SMGGEVLDFLRALAGATKPIVSGVDGLAIGIGTTIHLHCDLTVSSARSVFKTPFVDLALVPEAASSLIAPRIMGHQRAFA 159
159184444 162 LLAMGEGFSAEQAMQAGLIWKVVAPEHVETETLALATRLAAKPQQALKIARDLVRGNPQDILARIEEEGRHFIAQLQSAE 241
222085091 160 LLALGEGLSAADAKDAGLIWKVTTPDALEAETLSLATRLAAKPPEALRIARNLIRGSTADVLARIDEEATLFAAQLKSAE 239
222147746 161 LLALGEGFSAEQAREAGLIWKVVEPDAVERETLALAANLAKKPPQALKIARDLLRGDRSLVLARLDEELAHFAARLKSAE 240
227821070 160 LLAAGEPLEAAEALQAGLIWKIVGENAVEEETLALAARLARKPPEALRIARDLIRGDRNDVLARIDKEAEHFAAQLKSTE 239
241203348 161 LLAAGEAFSAEEAKEAGLVWKVVDPGEVDSLTLGLAAKLAAKPPEALRIARDLIRGDRGEIIARIDEEARYFSARLKSAE 240
209548162 161 LLAAGEGFSAAEAKDAGIIWKVVEPGEVDAVTLATAARLAAKPPEALRIARDLIRGDSGEIIARIDEEARHFSARLKSAE 240
116250740 161 LLAAGEAFSAEEAKEAGLVWKVVEPGEVDALTLGLAAKLAAKPPEALRIARDLIRGDRGEIIARIDEEARYFSARLKSAE 240
86356552  160 MLAAGEAFSAEEAREAGLIWKVTTPDEVEHAALAAATKLAAKPPEALKIARDLICGSREEVIARIDVEARHFATRLKSAE 239
150395713 160 LLAAGEPLDAAGAREAGLIWKIVDEPAVEEETLSLAGRLARKPPEALRIARDLVRGDRSDVLARIEEEAKHFAAQLKSAE 239
15964629  160 LLAAGEPLDAAGAREAGLIWKIVEETAVEEETLSAAARLAKKPPEALRIARDLIRGDRSDVLARIEEEAKHFAAQLKSAE 239
159184444 242 ARAAFEAFMRR 252
222085091 240 ARAAFEAFMKR 250
222147746 241 ARAAFEAFLAR 251
227821070 240 ARAAFEAFMRR 250
241203348 241 ARAAFEAFMRR 251
209548162 241 ARAAFEAFMRR 251
116250740 241 ARAAFEAFMRR 251
86356552  240 ARAAFEAFMRR 250
150395713 240 ARAAFEAFMRR 250
15964629  240 ARAAFEAFMRR 250
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap