Conserved Protein Domain Family
PRK06015

?
PRK06015: PRK06015 
2-dehydro-3-deoxy-phosphogluconate aldolase
Statistics
?
PSSM-Id: 168348
View PSSM: PRK06015
Aligned: 23 rows
Threshold Bit Score: 326.385
Threshold Setting Gi: 222087151
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
83269037    1 MKGQPVIPVLLIDKVEHAVPLARALARGGLPAIEITLRTAAALDAIRAVADEVPEAIVGAGTILNAKQYEDAAKAGSRFI 80 
189022310  12 MKGQPVIPVLLIDKVEHAVPLARALARGGLPAIEITLRTAAALDAIRAVADEVPEAIVGAGTILNAKQYEDAAKAGSRFI 91 
148558463  12 MKGQPVIPVLLIDKVEHAVPLARALARGGLPAIEITLRTAAALDAIRAVADEVPEAIVGAGTILNAKQYEDAAKAGSRFI 91 
62317043   12 MKGQPVIPVLLIDKVEHAVPLARALARGGLPAIEITLRTAAALDAIRAVADEVPEAIVGAGTILNAKQYEDAAKAGSRFI 91 
161620173  45 MKGQPVIPVLLIDKVKHAVPLARALARGGLPAIEITLRTAAALDAIRAVADEVPEAIVGAGTILNAKQYEDAAKAGSRFI 124
256014879  45 MKGQPVIPVLLIDKVEHAVPLARALARGGLPAIEITLRTAAALDAIRAVADEVPEAIVGAGTILNAKQYEDAAKAGSRFI 124
17988353   27 MKGQPVIPVLLIDKVEHAVPLARALARGGLPAIEITLRTAAALDAIRAVANEVPEAIVGAGTILNAKQYEDAAKAGSRFI 106
225685950  12 MKGQPVIPVLLIDKVEHAVPLARALARGGLPAIEITLRTAAALDAIRAVANEVPEAIVGAGTILNAKQYEDAAKAGSRFI 91 
163844283  12 IKGQPVIPVLLIDKVEHAVPLARALARGGLPAIEITLRTAAALDAIRAVADEVPEAIVGAGTILNAKQYEDAAKAGSRFI 91 
153011572  12 MTGQPVIPVLLIDKVEHAVPLARALAKGGLPAIEITLRTAAALDAIRAVASEVPEAIVGAGTILNAKQYEDAAKAGSRFI 91 
83269037   81 VSPDATKYIVAAANDSDVPLLPAAITPGEMLALREEGYTHLKFFPAEQAGGAPFLKALSSPLAGTFFCPTGGISLANART 160
189022310  92 VSPDATKYIVAAANDSDVPLLPAAITPGEMLALREEGYTHLKFFPAEQAGGAPFLKALSSPLAGTFFCPTGGISLANART 171
148558463  92 VSPGATKYIVAAANDSDVPLLPAAITPGEMLALREEGYTYLKFFPAEQAGGAPFLKALSSPLAGTFFCPTGGISLANART 171
62317043   92 VSPDATKYIVAAANDSDVPLLPAAITPGEMLALREEGYTHLKFFPAEQAGGAPFLKALSSPLAGTFFCPTGGISLANART 171
161620173 125 VSPGATKYIVAAANDSDVPLLPAAITPGEMLALREEGYTHLKFFPAEQAGGAPFLKALSSPLAGTFFCPTGGISLANART 204
256014879 125 VSPGATKYIVAAANDSDVPLLPAAITPGEMLALREEGYTHLKFFPAEQAGGAPFLKALSSPLAGTFFCPTGGISLANART 204
17988353  107 VSPGATKYIVAAANDSDVPLLPAAITPGEMLALREEGYTHLKFFPAEQAGGAPFLKALSSPLAGTFFCPTGGISLANART 186
225685950  92 VSPGATKYIVAAANDSDVPLLPAAITPGEMLALREEGYTHLKFFPAEQAGGAPFLKALSSPLAGTFFCPTGGISLANART 171
163844283  92 VSPGATKYIVAAANDSDVPLLPAAITPGEMLALREEGYTHLKFFPAEQAGGAPFLKALSSPLAGTFFCPTGGISLANART 171
153011572  92 VSPGATKYIVAAANDSDVPLLPAAITPSEMLALREEGYTHLKFFPAEQAGGASFLKALSSPLAGTFFCPTGGISLANARN 171
83269037  161 YLPLPNVLCVGGSWVAPKELVEAGNWNAITDLAKDAAALKA 201
189022310 172 YLPLPNVLCVGGSWVAPKELVEAGNWNAITDLAKDAAALKA 212
148558463 172 YLPLPNVLCVGGSWVAPKELVEAGNWNAITDLAKDAAALKA 212
62317043  172 YLPLPNVLCVGGSWVAPKELVEAGNWNAITDLAKDAAALKA 212
161620173 205 YLPLPNVLCVGGSWVAPKELVEAGNWNAITDLAKDAAALKA 245
256014879 205 YLPLPNVLCVGGSWVAPKELVEAGNWNAITDLAKDAAALKA 245
17988353  187 YLPLPNVLCVGGSWVAPKELVEAGNWNAITDLAKDAAALKA 227
225685950 172 YLPLPNVLCVGGSWVAPKELVEAGNWNAITDLAKDAAALKA 212
163844283 172 YLPLPNVLCVGGSWVAPKELVEAGNWNAITDLAKDAAALKA 212
153011572 172 YLSLPNVVCVGGSWVAPKELVEAGDWDAITDLASEAADLKS 212
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap