Conserved Protein Domain Family
flgB

?
PRK06003: flgB 
flagellar basal body rod protein FlgB; Reviewed
Statistics
?
PSSM-Id: 168340
View PSSM: PRK06003
Aligned: 38 rows
Threshold Bit Score: 203.317
Threshold Setting Gi: 121601960
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
222084862   1 MQPIQLFDLASRQAEWLQTRQEVVAGNIANANTPKFRAKDVTPFQAVLDNQNVGMAKTNPAHLSGNefsqSGDINVEEAS 80 
218528663   2 TTGVYLFDLASQHARFLATRQATIAGNVANANTPGYKARDVMPFAQVLARTGLDMASTATSHLGTQ----GTGIPVREAK 77 
188579864   2 TTGVYLFDLASQHARYLATRQATIAGNVANANTPGYKARDVVPFAQVLARTGLDMSSTANTHLATE----GNRIPVRETK 77 
170741833   1 MSGIYLFGLASRRAQYLSVRQATVAGNIANADTPGYKARDVVPFAEVLSRAGLDLAATSQGHLRA-----GTTTPTAKVK 75 
240137194   2 TTGVYLFDLASQHARFLATRQATIAGNVANANTPGYKARDVMPFAQVLARTGLDMASTATSHLGTQ----GTGIPVREAK 77 
163850060   2 TTGVYLFDLASQHARFLATRQATIAGNVANANTPGYKARDVMPFAQVLARTGLDMASTATSHLGTQ----GTGIPVREAK 77 
254559206   2 TTGVYLFDLASQHARFLATRQATIAGNVANANTPGYKARDVMPFAQVLARTGLDMASTATSHLGTQ----GTGIPVREAK 77 
182680551   1 MGPVTVLDLVSQQARWLTLRQATIAQNIAQANTPGFKSVDLLPFEQVYSESGLRMTATSPKHLAAD----PNEADLTAGH 76 
90422607    1 MGPIYLFDVASSQAQWLSLRQATISSNVANANTPGYQAKDIESFSKLLDGKLIPVAVTSPMHIAS-----GTAANPGETR 75 
217976222   1 MGSIHLFDLSSQQARWLTVRQSVIAANVANANTPGFTASDVTPFEDVFNDASIRLAATDPGHIGID----PLASDQVSVK 76 
222084862  81 LNQEIGVQESGNTVGLEDELAKSGEIKRQYSLNTALVSSFHRMMLMTVKQ 130
218528663  78 PTETWEVLQSSSAVSLEQEMLKAGDVSRQHNLDTAVVKSFHRMLMAAVKG 127
188579864  78 AAETWEVLQSSSAVSLEQEMLKAGDVSRQHNLDTAVVKSFHRMLMAAVKS 127
170741833  76 PSESWDAIQGGHSVSLEQEMLKSNDIARDFNLNTAVVKAFHRMMLSGVRS 125
240137194  78 PTETWEVLQSSSAVSLEQEMLKAGDVSRQHNLDTAVVKSFHRMLMAAVKG 127
163850060  78 PTETWEVLQSSSAVSLEQEMLKAGDVSRQHNLDTAVVKSFHRMLMAAVKG 127
254559206  78 PTETWEVLQSSSAVSLEQEMLKAGDVSRQHNLDTAVVKSFHRMLMAAVKG 127
182680551  77 TEAGWETTHSGNSVSLEQELMKTGEIHGAYTLNTNIARSFQQMLLTAVKA 126
90422607   76 EKDSWDIVHSGNSVSLEQEMLKAGDVNRDYSLNTAIVKSFQRMFMSSTKG 125
217976222  77 DGAAWETTHSGNSVSLENEMMKAGEVNRSFSLNSSIVKSFNQMLMASVKG 126
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap