Conserved Protein Domain Family
PRK05975

?
PRK05975: PRK05975 
3-carboxy-cis,cis-muconate cycloisomerase; Provisional
Statistics
?
PSSM-Id: 168324
View PSSM: PRK05975
Aligned: 26 rows
Threshold Bit Score: 436.408
Threshold Setting Gi: 154246625
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
154246625   1 MSVSVFEHPFLRPLLGDDAIAAAFTAEADIAAMLRFEAALAEAEAEAGVIPHEAAAAIAQAARSIAVAPADLAAAVARDG 80 
227820347   1 MTYSAFDHPYLSGLLGDEAVAAEFSAAAEIRAMLAFEAALARAEAQHGVIPAAAADRITEACRAFSPDVAALRRGLAVDG 80 
209546324   1 MTASPFDHPFLSGLLGDDEIAPYFSAEADIRAMLSFEAALARAEAAHGLIPAEAARRIAEICAGFSADLHRLRAATARDG 80 
116255285   1 MTASPFDHPFLSGLLGDNEIAPYFSAEADIRAMLSFEAALAKAEAAHGLIPAEAARRIAETCAAFSPEVSNLRSATARDG 80 
86360333   12 MTASPFDHPFLSGLLGDDEIAPHFSAEADIRAMLSFEAALARAEAAHGLIPAEAARKIAEACTGFSPDLASLRSAMAKDG 91 
190895376   1 MTASPFDHPFLSGLVGDDEIAPYFSAEADLRGMLSFEAALAKAEADHAVIPAEAARQIAAACTGFSPDLASLRAATARDG 80 
150376352   1 MTYSAFDHPYLSGLLGEEAVAAEFSVAADVRAMLAFEAALARAEARHGIIPEAAANRINEACRAFSPDVGAMRRATAVDG 80 
16265235    1 MTYSAFDHPYLSGLLGDEAVAAEFSVVADVRAMLAFEAALARAEARHGVIPEAAANRIAEACRGFSPDVGAMRRATAIDG 80 
13476007    1 MTVSPFDHPLLSALLGDEEASRHFSVEAEIEAALAFEGALAEAEAENGIITRDAAAAIVAALNPFRPDTALLRTAVAKDG 80 
99080396    1 MNPLTSSNPYFAGLFADQEITALFEGAATADAFLAYEMALTRAAAEVGQIDIGLAQRALAAMVDFTPDVAELQSDLSADG 80 
154246625  81 VVIPELVRRLRAAVGEPHAGFVHKGSTSQDVIDTSLFLRLKAASDILLARLDALVGSFDRLASTTGALALTGHTRMQRAR 160
227820347  81 VSVPELVRQLRRAVGEAAAEHVHYGATSQDVIDTSLMLRLKAIGELFSGRLGEIAAVLEEGARQWGGRPLMGRTRMQAAI 160
209546324  81 VVVPELIKQLRTEVGEEAAKSLHLGATSQDVIDTGLMIRLKAIVFLFAGRLSAIVAGLDGLDRQFGRNRLMGHTRMQAAI 160
116255285  81 VVVPDLIKQLRASVGEEAAKSLHFGATSQDIIDTSLMIRLKAVVFLFAGRLSTIAAGLHALDGQFGRNKLIGHTRMQAAI 160
86360333   92 VVVPDFVKQLRAKVGEEAGKNLHLGATSQDVIDTSLMIRLKAVVFLFAGRLSAIIAALEGLDRQFGGNRLMGHTRMQAAI 171
190895376  81 VVVPDFIKQLRAAVGEEAAKNLHLGATSQDVLDTSLMIRLKAVVFLFAGRLSAVIAGLDGLDGRFGGNRLMGHTRMQAAI 160
150376352  81 VVVPELVRQLRRAVGEEAAEHVHLGATSQDVIDTSLMLRLKALAELFSGRLGSVLTALEACEREWGERPLTAHTRMQPAL 160
16265235   81 VVVPELVRQLRRAVGEEAAEHVHFGATSQDVVDTSLMLRLKAIAELFSGRVGDVVTALEACGRHWGERALTAHTRMQPAI 160
13476007   81 VMVPELVRQIRAMVGEPHGDKVHFGATSQDVIDTSLVLRLKAIVEHLGLLLTETVLRLTSLEERFGGRALAGMTRMQPAI 160
99080396   81 MAVPGYVRQLKAHVGAECVAAVHPGATSQDLIDTAQALALRAANEIYISRLTTLIDALRDLEETHGDNRLMGRTRMQAAL 160
154246625 161 PITLAHKVATWREPLARHRARFPAVAddlFRVQLGGAVGNRAELGEAAGRVADGLATRLGL-GAAPRAtHAERDAIAAYG 239
227820347 161 PITVMDRMRTWVEPLLDHQDRLDAMDidlFAVQFGGAAGTLDKLEGKADAVRATLAEELAL-IDCPQW-HSQRSAIADFA 238
209546324 161 PISVSDRLAAWRAPLETYRDRLTEQS---FPVQFGGAAGTLDKLGPQGPAIRAALAQELGL-TDCRQW-QSERLPIADIA 235
116255285 161 PITVSDRLRAWREPLATYRDRLTEQG---FPVQFGGAAGTLDKLGSQAATIRASLAQELGL-TDAPQW-QSGRLPIADIA 235
86360333  172 AISVSDRLNVWRAPLATYRDRLTEQS---FPVQFGGAAGTLDKLGPQGPAVRASLAQELGL-SDTRQW-QSARLPIADIA 246
190895376 161 PITVADRLAAWRAPLTTYRDRLTEQN---FPVQFGGAAGTLDKLGPQATAIRASLAQELGL-TDMSQW-QSTRLVIADIS 235
150376352 161 TITVADRLRSWIEPLLDHQDRLDAADldlFAVQFGGATGNLEKLKGKADIVRATLAEELAL-VDCPQW-HSQRSPIADIA 238
16265235  161 AITVADRLRSWIEPLLDHQDRLDTTGtdiFAVQFGGAAGTLEKLKGKADIVRATLAEELAL-VDCPQW-HSQRLPIADFA 238
13476007  161 PIQVTDRITAWRAPLQRQQKSLSDQSgrlLVVQFGGAAGTLEKLGDKGPAVRAALAAKLGL-ADAPQW-QSQRDALADFA 238
99080396  161 PISAGHRISSWISPLVRHTSRLEILRpevEALQFGGPVGDGQRSQPHAAAMADHMGKALGLrAPERCW-HTERDSLVTYA 239
154246625 240 HWCALLAGSLGKFGADIALMAQNEvGEVTIAGGGGSSAMPEKNNPVGAEILVTLARFAATLQGGLDQALVHENERSGAAW 319
227820347 239 HLLTLITGSLGKFGQDVALMAQAG-DEIVLAGSGASSAMAHKQNPVAAEVLVTLARFNATQVSGIHQALVHEQERSGSAW 317
209546324 236 SLFASISGSLGKIGQDIALLAQAG-QEIEIAGGGTSSAMAHKQNPVAAETLVSLARFNATALSGIHQSLVHEQERSGAAW 314
116255285 236 GLFASISGSLGKMGQDIALLAQAG-DEIEISGGGTSSAMAHKQNPVSAEVLISLARFNATLLSGIHQSLVHEQERSGAAW 314
86360333  247 GLFASISGSLGKIGQDIALLAEMG-GEIEVSGGGASSAMAHKQNPVAAEVLVSLARFNATALSGIHQSLIHEQERSGAAW 325
190895376 236 GLFASISGSLGKIGQDIALLAQVG-REIEISGGGTSSAMAHKQNPVAAEVLVSLARFNATALSGIHQSLVHEQERSGAAW 314
150376352 239 HLLSLVTGSLGKFGQDVALMAQAG-DEIVLAGGGASSAMSHKQNPVAAEVLVTLARFNATQVSAIHQSLVHEQERSGSAW 317
16265235  239 HLLSLVTGSLGKFGQDVALMAQAG-DEIVLAGGGGSSAMPHKQNPVAAEVLVTLARFNATQVSAIHQSLVHEQERSGSAW 317
13476007  239 GWLALLTGSLGKFGQDIALMAQGG-TDIMLSGGGGSSAMPHKQNPVKAEALVALARFNATQLSGMHQALLHEQERSGAAW 317
99080396  240 GWLSALTGSLGKFGQDVCLMVQQGvDALAQAGGGSSSAMAHKQNPVTAEMLVTLSRYNAGQVALMHQASVHEQERSGAMW 319
154246625 320 TLEWMILPQLVTTAGAATRTAFALIEALRFPAAS 353
227820347 318 TLEWLLLPQIVGATAAALRLATELAGNIRRLGAA 351
209546324 315 TLEWLLLPQMTMATAASLRLAGELTGNIKRLGTA 348
116255285 315 TLEWLLLPQMTMATAASLRLAKELTGNIKRLGTT 348
86360333  326 TLEWLLLPQMTMGTAASLRLARELTGNIKRLGTG 359
190895376 315 TLEWLLLPQMAMATAASLRLAKELVGNIRRLGIA 348
150376352 318 TLEWLILPQMVGATAAALRLAAELAGNIRRLGRV 351
16265235  318 TLEWLILPQMVGATAAALRLAAELAGNVRRLGRV 351
13476007  318 TLEWLLLPQMAVATAASLRLAAELAGQIEGLGH- 350
99080396  320 TLEWMVLPAMMTCTGAALRLATRQVQAITRIGEP 353
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap