Conserved Protein Domain Family
PRK05973

?
PRK05973: PRK05973 
replicative DNA helicase; Provisional
Statistics
?
PSSM-Id: 168322
View PSSM: PRK05973
Aligned: 12 rows
Threshold Bit Score: 293.095
Threshold Setting Gi: 15966053
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
27380369    1 MRLSAPIYHLKRKAKRLSREEGIPLHDALDRIATTEGFSAWSMLAAKAAAMTP--ANRLFPQFRPGDLVLVGARPGQGKT 78 
159186159   1 MKLSTPIFQLKRRAKLMVRNNAIPLHEALDQIAREEGFARWSLLSAHVAAGSL--SENLFSRIVHGDMLLLAGRPGQGKT 78 
222087618   1 MRLSAPLYRLKHKARLLSRQENIPLHQALDRIAAEEGFRSWSLLATRADETTP--AGEIFSRLKLGDLVLLGARPRHGKT 78 
116252879   1 MKMSAPIYHLKRKAKALSRAENLPLHQALDRIAQNEGYSGWSLLAAKAAAEAP--AGKLFQQLLPGDLLLVGARPGHGKT 78 
190892397   1 -------------------------------------MGRWSLLAAKASETTP--ASELFAHLRPGDLLLVGARPGHGKT 41 
153008117   1 MRLSSPIYHLKRLARRLANDADIPLHEALDRVAAQEGYRSWSLLVDNTSAPVS--AREIYGYLKSGSMVLIGARPGHGKT 78 
39937395    1 MRLSAPVYRLKRKAKLLSRAQNVPLHAALDHVAATEGFERWSLLVESAAA-SP--AVRLFGALNPGDLVLLGARPGQGKT 77 
192293174   1 MRLSAPVYRLKRKAKLLSRAQNVPLHAALDHVAATEGFERWSLLVESAAA-SP--AVRLFGALNPGDLVLLGARPGQGKT 77 
15966053    1 -------------------------------------------------------------------MLLVAGRPGHGKT 13 
121583563   1 MKMSVPVYSLKRLAKDLSRERKIPLHAALNRVAQEEGFASWSLLAARLSAESP--ARELLSQLAPGDLVLLGARPGHGKT 78 
83645759    1 MKLTAPVHVLKGKAKALKRSQSLTMTEALDQIARAEGFSSWSLLQPKVKAFTPktTEELLDYLHPGDLLLIGARPGLGKT 80 
89053563    1 MRLSSPIYTLKRQARLLARDTDLRLHEALDQIATQEGFQDWSHLASNYARTTP--AMDLMRQISSGDLVLIGARPGQGKT 78 
27380369   79 LMSLELAVEAMKSGHRAAFFSLEYTGKDVLDRLRAIGVDPAQFadmfEVDCSDAISADYVVKQMAA-APRGTVVVIDYLQ 157
159186159  79 ALGFELLRAAAEDGRQSVLLTLEMTEQQARKRIEKHAAGKRET----EIVTSDEICADYIIRHLSP-ARPGTFAVIDYLQ 153
222087618  79 LMSLRLAVEAMKSGNRGIFFTLEYTEREVVDRFEAIGAEFEHFrglfEFDSSDAISADYIIERLAS-APKGTLVVVDYLQ 157
116252879  79 LMGLELAVEAMKSGRPGVFFSLEYTEEDIADRFRAIGVDRAQFerlfEFDGSDAISAAYIAERLAS-APRGTLVVIDYLQ 157
190892397  42 LMGLKLAVEAMKSGHPGVFFSLEYTRENVDDRFCAIGVDRSQFdhlfEFDGSDAISADHMTARLVS-APRGTLVVVDYLQ 120
153008117  79 LLSLDIMIEAMRDGNYGLFFSLEYTETDIAGRFKALGVDRDNFrhlfRFDCSDAICADYMIAKLDA-ASAGTVVIVDYLQ 157
39937395   78 LLSLELAVEAIKAGRTSAFFTLEYTEAEVLTRLRAIGADPASLadkfTLDTSDAICSDYIIARLAS-AARGSLVVIDYLQ 156
192293174  78 LLSLELAVEAIKAGRTSAFFTLEYTEAEVLTRLRAIGADPASLadkfTLDTSDAICSDYIIARLAS-AARRSLVVIDYLQ 156
15966053   14 TLGLQLLLDAARDGRKAVFFTLEFTEQQARRHLRSLDEGRHGLcdklQILTSDDISADYIIRHLSG-SERGTVAVIDYLQ 92 
121583563  79 LMGLELAVKSVQSGRYGWFFTLEWNMSDLLSGLRTLGKDPSAIgerfEFDNSNAICATYIIDQLAS-AESGTVVVIDYLQ 157
83645759   81 TMALQLLLQAIKQGRQCFFFSLEYSKKALIEKLTALDQQFELNqpllALDISDEISADYIINQTKErVTEGSLIAVDYLQ 160
89053563   79 LLGLELAAVAHKHNRTGYFFTLDYNETDVRDRFDELGFDQRGHerpvIVDTSDDICAAHIIDRLGN-GPGDGLVVVDYLQ 157
27380369  158 LLDQRRENPDVTVQVRALKSFARDKGLIVVFISQIDRSYDPSVKPCPDLDDVRLPNPLDLKLFDKRAsstiprfssgrra 237
159186159 154 ILDQQRHKPDLSQQVTALGEFAQKTGVIFAFISQVDRSFDPENKRLPDMRDIRLPNLLDLGLFTKAC------------- 220
222087618 158 ILDQNRQKPELMVQVQALKAFAREKGLVIVFISQIDRSYESSAKTYPDLEDVRLPNPLDLGLFDKTF------------- 224
116252879 158 LLDQKRENPELSVQVRTLKAFARERGLIVVFISQIDRSYERSHKPLPDIADIRLPNPLDLKLFDKTC------------- 224
190892397 121 LLDQKRENPELSAQVGILKVFARQRGIIMVFIAQIDRSFEMARKPLPDIGDIRLPNPLDLQLFDKTC------------- 187
153008117 158 ILDQKREKPDLSTQIAALRSFASKRRLTILCISQIDRSFDPAAKPCPGIEDVRLPNPLDLTLFDTCL------------- 224
39937395  157 LLDRRRDTPDLNSQIRALRSFARRAGVILVIISQIDRSYDPAKKRCPDLSDVRLMNELDLSLFSHAC------------- 223
192293174 157 LLDRRRDTPDLNSQIRALRSFARSAAVILVIISQIDRSYDPAKKRCPDLSDVRLMNELDLSLFSHAC------------- 223
15966053   93 ILDQQRSKPALSDQVLALGDFARQTGVVFGFISQVDRSFDPESKRLPDIRDIRLPNLVDLRLFNKAY------------- 159
121583563 158 LLDQKREHPELAVQVRSLKAFARDRGLIVVFISQIDRSYDPVASPLPGLADVRLPNPLDLTLFDRTC------------- 224
83645759  161 LLDQNRNKPPLQQQIEDLKSYARAKKCILVFISQIDRRFDEGERAIPTIKDVRLPNPLDMNLFNKSV------------- 227
89053563  158 QLDQRRRHPPLEDQVRALKDFATEHGTIIVLISQIDRAFELSSRGVPGIDDIRLPNPVDVSLFDRRC------------- 224
27380369  238 dgfrprvgWFTRGLQHHAAFR 258
159186159 221 --------FLHNGEAQLHNVN 233
222087618 225 --------FLNKGEVQIRAAG 237
116252879 225 --------FLNNGQVAFQATR 237
190892397 188 --------FLNNGKMVFGAAA 200
153008117 225 --------FLNNGEIRVQSRD 237
39937395  224 --------FVGADEIRWSPVP 236
192293174 224 --------FVGADEIRWSPVP 236
15966053  160 --------FLHNGEARLQDVA 172
121583563 225 --------FLNNGAIQVSAVN 237
83645759  228 --------FVKSGQIYI---- 236
89053563  225 --------FLHGGDIQIEMAA 237
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap