Conserved Protein Domain Family
PRK05968

?
PRK05968: PRK05968 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 168320
View PSSM: PRK05968
Aligned: 21 rows
Threshold Bit Score: 618.634
Threshold Setting Gi: 89056043
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
222106727   1 MNETPRFDPAAKTIPVPPpagftGHDPFDAAVPPIYQTSLFLFDSYAELEDVFAGRSHKPIYSRGDNPTVQILEHRIAEM 80 
158424867   1 MNKPLDHEALPAQGGWSR-----EVNLLAAAVPPIFQTSLFTFDTYADMAAVYAGRSHQLIYSRGDNPTVMAFERAVAEL 75 
222081790   6 AMNETPRFDAYHRVTSDTlm-pvQDDPFNAAVPPIYQTSLFLFDSYSDLEDVFAGRSKKPIYSRGDNPTVQLLERRIAEM 84 
227823084   1 MNDGLDPFDRASLIAVHD-----EGHAFDAVVPPIVQTSLFTFKDYDEMIASYRGERVRPIYTRGLNPTVRLFEEMLAKL 75 
116248987   3 MNQSINPHDLGAHAAADDlftpvDPAAFNAVSPPIFQTSLFTYDSYEAMEDVFAGRTRNYIYSRGDNPTVREFELLVARL 82 
86361191    1 MNQSFSPRDLGAHAAADDlftpvHPAAFNAVSPPIFQTSLFTYDSYEAMEDVFAGRTRNFIYSRGDNPTVREFELLVARL 80 
190895020   1 MNQSFSPCDLGAHAAADDlftpvDPAAFNAVSPPIFQTSLFTYDSYEAMEDVFAGRTRNFIYSRGDNPTVREFELLVARL 80 
150397619   1 MSNGLDPFERASLIVAHD-----ESNAFDAVVPPIVQTSLFTFKDYDEMLSSYRGERVRPIYTRGLNPTVRHFEEMLAKL 75 
15966263    1 MNNGLDPFERASLIVAHD-----ESNAFDAVVPPIVQTSLFTFKDYDEMVASYRGERVRPIYTRGLNPTVRHFEEMLAKL 75 
217979443   1 MNRVFIPPSGSEPATGSAgr--tRAYALDAASPPIFQTSSFFFDNFDDMADVYAGRSRRLIYSRGDNPTVMEFERVMAEL 78 
222106727  81 EGAEAARAFSSGMGAIAATILAFVNSGDRIVTVRHVYSDAFRFFEKVLKRFGVLVDYIDGTDTESLIAALPGAKIAYLES 160
158424867  76 EGAEAGRAFSSGMGAISATVLALVSAGDRIVTVRNVYSDAYRLFELMLSRFGVVVDYVDGTDAEAVEAVLPGAKLLYLES 155
222081790  85 EGAEEARAFSSGMGAIAAAVLAFVGPGDRIVTVRHVYSDAFRFFEKVLKRFGVIVDYIDGTDTEKMIVAIPGAKVVYLEN 164
227823084  76 EGAGDAIGFASGMSAISSTVLSFVEPGDRIVAVKHLYPDAFRLFGTHLKRMRIEVTYVDGRDEEEVAKALPGAKLFYMES 155
116248987  83 EGAEDGRAFSSGTAAITSTILSLVEAGDRVVAVRHLYNDVYRLLVKLLARLGVAVDFVDPADHDEVRKALSGAKLLYLEN 162
86361191   81 EGAEDGRAFSSGTAAITSTILSLVEAGDRVVAVRHLYNDVYRLLVKLLGRLGVTVDFVDPSDHDEVRKALPGAKLLYLEN 160
190895020  81 EGAEDGRAFSSGTAAITATILSLVEAGDRVVAVRHLYNDVYRLLVKLLGRLGVTVDFVDPSDHEEVRKTLPGAKLLYLEN 160
150397619  76 EGAEDAIGFASGMSAISSSVLSFVEPGDRIVSVKHVYPDAFRLFGTHLKRMRIEVTYVDGRDEEAVARALPGARLFYMES 155
15966263   76 EGAEDAIGFASGMSAISSTVLSFVEPGDRIVAVKHVYPDAFRLFGTHLKRMRVEVTYVDGRDEEAVAKALPGAKLFYMES 155
217979443  79 DGAEAARAFSSGMGAIAATIIAFVSAGDRIVTVRNVYSDAYRLFELVLAKFGVTVDYLDGADAGAIAAALPGAKLLYLET 158
222106727 161 PTSMVFELQDLVAVGAAARRHGVLTIVDNSWATPLYQKPIAAGIDLVIHAASKYLGGQSDTVAGLVTGSKEHIARINGEI 240
158424867 156 PTSLAFELQDIARLARAARTHGVVSVIDNSWATPLFQRPIAHGVDLVVHAASKYLGGHSDTVAGVVVGSAELVGRINASS 235
222081790 165 PTSMVFELQDLTAIAEAARRHGVVTMVDNSWATPLYQNPLAVGIDLVIHAASKYLGGQSDTVAGLVAGSRAHINRINSEI 244
227823084 156 PTSWVMDTHDVAALAALAKAQGIVTVIDNSWASPVFQQPISLGVDLVIHSASKYLGGHSDVVAGVVAGSTELIGRIRSEA 235
116248987 163 PTSFVFELQDIAALSAMAKEAGVTSIIDNSWATPLFQKPIQHGVDIVIHAASKYLGGHSDTVAGVVVGSKEAIARINATS 242
86361191  161 PSSFIFELQDIVALSAMAKEAGVTTIIDNSWATPLFQKPVQHGVDIVVHAASKYLGGHSDTVAGVVVGSKEAIAKINSTS 240
190895020 161 PSSFIFELQDIVALSAMAKEAGVTTIIDNSWATPLFQKPIQHGVDIVIHAASKYLGGHSDTVAGVVVGSKEAIAKINSTS 240
150397619 156 PTSWVMDTHDVASLAALAREQGIVTVIDNSWASPVFQQPISLGVDLVIHSASKYLSGHSDVVAGVVAGSSALIGRIRSEA 235
15966263  156 PTSWVMDTHDVAALAALARRQGIVTVIDNSWASPVFQQPVSLGVDLVIHSASKYLGGHSDVVAGVVAGSGELIGRIRSEA 235
217979443 159 PTSLTFELQDIATLAALARAQGVVSVIDNSWATPQFQKPIAHGVDLVIHAASKYLGGHSDTVAGVVSGSAEHVARINAGA 238
222106727 241 FPYTGAKLSPFEAWLVLRNLETLPFRMRHHHEAGLEVAHWLKASQAVGRVMHPVFSDHPgRTTLTGFGGLFSFEVTDDID 320
158424867 236 YAYLGAKLSPFEAWLLLRGLHTLPMRMARHMSSGLALAERLRAHPDVELVRHPAFSDHPgRASLSGFAGVFSFEVGEAID 315
222081790 245 YPYTGAKLAPFEAWLVLRNLETLPFRMRHHHEAGLEVASWLKSADAVANVMHPAFAEHPgKSTFSGFGGLFSFEVAHHID 324
227823084 236 YPYLGGKLSPFDAWLLIRGLRTLPIRMKAHERSALALARRLQDHPLVETVCHPGLGNHL-PPGLLGTSGLFSFIVRDGVD 314
116248987 243 YPYVGAKLSPFEAWLLLRGMRTLRVRLKEHERSGLLLAGRLKEHSAIGCVRHPAFQEHPgRATLTGYAGLFAFDLNPDID 322
86361191  241 YPYVGAKLAPFEAWLLLRGMRTLRVRLKEHERSGLLLADRLKQHPGIARVRHPAFQDHPgRATLTGYAGLFAFDLTPDID 320
190895020 241 YPYVGAKLAPFEAWLLLRGMRTLRVRLKEHERSGLLLADRLKQHPDIARVRHPAFQDHPgRATLSGYAGLFAFDLTPDID 320
150397619 236 YPYLGGKLSPFDAWLLIRGLRTLPIRMKAHERSALAVARRLAEHPLVETVCHPGLGNHL-PPGLSGTSGLFSFIFREGVD 314
15966263  236 YPYLGGKLSPFDAWLLIRGMRTLPVRMKAHERSALAVARRLAEHPLVETVCHPGLGNHL-PPGLSGTSGLFSFIFREGVD 314
217979443 239 YAYLGAKLSPFEAWLLLRGLATLELRLPRHMQSGLLIAGRLKAHPNVSLVRHPAYSDHPgKATLSGFSGLFSIEVGENID 318
222106727 321 VATFVDALQLVRIGVSWGGPESLVVPAKAALSIsPETNVFARFGVSDRTIRLNVGLHEAKAIIADLDQALAQAAR 395
158424867 316 VPTFVDALRLVRIGVSWGGPESLVVPALAPLQL-AKANCFARFGISPRLIRLSAGMEDETLIWADIEQALHGARR 389
222081790 325 VASFVDALRLVRIGVSWGGPESLVVPAKAALSIsPETNVFARFGVSDRTIRLNVGLHDAKSIIADLEQAFAVAAK 399
227823084 315 VRRFADHLQFFKLGVSWGGHESLIVPGEVVLAQkAQPNSAAAFGISPRSVRLHVGLEGTEALWSDLEAAIDAASS 389
116248987 323 VARFVNSLRDIRLGVSWGGPETLVVPAKVALQIpDRMTSFIRFGVSEQTVRFAVGLEEPELLWSDLQQALHAAKR 397
86361191  321 VARFVNALREIRLGVSWGGPETLVVPAKVALQIpDRMTTFIRFGVSEQTIRFAVGLEEPELLWNDLQQALHAAKR 395
190895020 321 VARFVNALREIRLGVSWGGPETLVVPAKVALQIpDRMTTFIRFGVSEQTIRFAVGLEEPELLWNDLQQALHAAKR 395
150397619 315 VRRFADHLKLFKLGVSWGGHESLIVPGEIVLRQkAEPNSAAAFGISPRSVRLHVGLEGTEALWSDLEAAMTAASS 389
15966263  315 VRRFADHLKLFKLGVSWGGHESLIVPGEVVLAQkAEPNSAAAFGISPRSVRLHVGLEGTEALWSDLEAAMTAASS 389
217979443 319 VRTFANALKLFRLGVSWGGPESLVVPALAPLQLrT-ANCFARFGVSPRLIRLHVGLEDAEALWDDLERALALARS 392
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap