Conserved Protein Domain Family
PRK05962

?
PRK05962: PRK05962 
amidase; Validated
Statistics
?
PSSM-Id: 168315
View PSSM: PRK05962
Aligned: 16 rows
Threshold Bit Score: 501.616
Threshold Setting Gi: 170748139
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
82699470    1 MEATLARLAARAGEEHVFSKIYAERARAEADAADTRLRAGRPLGPLDGRIVSIKDLFDVAGEPTLAGSVVRHDAPPAGCD 80 
256369013  34 LEATLARLAARAGEEHVFSKIYAERARAEADAADTRLRAGRPLGPLDGRIVSIKDLFDVAGEPTLAGSVVRHDAPPAGCD 113
225852103   8 LEATLARLAARAGEEHVFSKIYAERARAEADAADTRLRAGRPLGPLDGRIVSIKDLFDVAGEPTLAGSVVRHDAPPAGCD 87 
163842852   8 LEATLARLAARAGEEHVFSKIYAERARAEADAADTRLRAGRPLGPLDGRIVSIKDLFDVAGEPTLAGSVVRHDAPPAGCD 87 
161618549   8 LEATLARLAARAGEEHVFSKIYAERARAEADAADTRLRAGRPLGPLDGRIVSIKDLFDVAGEPTLAGSVVRHDAPPAGCD 87 
227823710  12 LEAVLARLAGRCDDERVFMKLYAESARAEAAAADRRQQEGKSLGPLDGRIVSIKDLFDIAGEPTLAGSIIRRMAPPASAD 91 
170743147  15 LERRLAAIGEEAG-RHVFTRVAARAARAEADAADARRRAGLSLGPLDGAIVSIKDLFDVAGEPTTAGSAIRRASPPAAAD 93 
220923651   8 LERRLSATEEPAS-RHVFTTLYPEAARAAADAADARRRVGISLGPLDGVIVSIKDLFDVAGEPTTAGSAIRRKAVPAAQD 86 
15966846   12 LETVLARLDGRRNDERVYVKLYPETARAEADAADGRRREGKSLGPLDGRIVSIKDLFDIAGEPTLAGSIIRRAAPPATAD 91 
150398181  12 LEAILAGLDLRRHEERAFVKLYPETARAEADAADRRRREKRSLGLLDGRIVSVKDLFDIAGEPTLAGSIIRRAAPSATAD 91 
82699470   81 ALIVQRLRNAGAVIIGKTHMTEFAFTPVGLNPHYGEPGNAIDPARIPGGSSSGAAVSVAEGTSEIAIGSDTGGSVRIPAA 160
256369013 114 ALIVQRLRNAGAVIIGKTHMTEFAFTPVGLNPHYGEPGNAIDPARIPGGSSSGAAVSVAEGTSEIAISSDTGGSVRIPAA 193
225852103  88 ALIVQRLRNAGAVIIGKTHMTEFAFTPVGLNPHYGEPGNAIDPARIPGGSSSGAAVSVAEGTSEIAIGSDTGGSVRIPAA 167
163842852  88 ALIVQRLRNAGAVIIGKTHMTEFAFTPVGLNPHYGEPGNAIDPARIPGGSSSGAAVSVAEGTSEIAIGSDTGGSVRIPVA 167
161618549  88 ALIVQRLRNAGAVIIGKTHMTEFAFTPVGLNPHYGEPGNAIDPARIPGGSSSGAAVSVAEGTSEIAIGSDTGGSVRIPAA 167
227823710  92 ATIVRRLRAAGAVIIGKTHMTEFAFTAVGLNPHYPVPGNAVDPMLIPGGSSSGAGVSVAEGTSDIAIGSDTGGSVRIPAA 171
170743147  94 APVVARLRRAGAVIVGKTNMTEFAFSGLGLNPHYGTPGNAADPARLPGGSSSGAGVSAALGTSDVAIGTDTGGSVRIPAS 173
220923651  87 APVVARLRRAGAVIIGKTNMSEFAFSGLGLNPHWGTPGNAADPTRIPGGSSSGAGVSVALGTSDIAIGTDTGGSIRIPAA 166
15966846   92 AAIVRRLRAAGAVIIGKSHMTEFAFTAVGLNPHYPVPGNAIDPSLIPGGSSSGAAVSAAEGTSEIAIGSDSGGSVRIPAA 171
150398181  92 AAIVRRLRAAGAVIIGKTHMTEFAFTAVGLNPHYPVPGNATDRSLIPGGSSSGAAVSAAEGTSEIAIGSDSGGSVRIPAA 171
82699470  161 LNGLVGFKPTARRIPLEGAFPLAPSLDSVGPLTRTVADAILADAVMAGEKPILPEVLPVNGLRIALPKDYLLADMEPDVA 240
256369013 194 LNGLVGFKPTARRIPLEGAFPLAPSLDSVGPLTRTVADAILADAVMAGEKPILPEVLPVNGLRIALPKDYLLADMEPDVA 273
225852103 168 LNGLVGFKPTARRIPLEGAFPLAPSLDSVGPLTRTVADAILADAVMAGEKPILPEVLPVNGLRIALPKDYLLADMEPDVA 247
163842852 168 LNGLVGFKPTARRIPLEGAFPLAPSLDSVGPLTRTVADAILADAVMAGEKPILPEVLPVNGLRIALPKDYLLADMEPDVA 247
161618549 168 LNGLVGFKPTARRIPLEGAFPLAPSLDSVGPLTRTVADAILADAVMAGEKPILPEVLPVNGLRIALPKDYLLADMEPDVA 247
227823710 172 LQGLVGFKPTARRVPLDGAFPLSPSLDSIGPLALSVADCALADAVMAGDRPEPLTPLPVDGLKLGIPKGVLLEELAPDVA 251
170743147 174 LNGVVGFKPTARRVPLAGAFPLSPSLDSIGPLARSVAACAAADAVMAGEEPAPLRPPALADLRIGVPRGLLFTDTDPGVA 253
220923651 167 LNGVVGFKPTARRVPLAGAFPLSPSLDSIGPLARSVQACADADTVLSGEEFGPLRPVALRDLRVGVPRGLLFTETDPMVA 246
15966846  172 LQGLVGFKPTARRISLEGAFPLSPSLDSIGPLARTVAGCAAADAVMAGDTPRPLERMPLAGLKLGIPEGALLEGLAPEIA 251
150398181 172 LQGLVGFKPTARRIPLEGAFPLSPSLDSIGPLARTVADCAAADAIMAGETPRPLEPVPLAGMKLGMPKGALLEGLATEIA 251
82699470  241 AHFEASLAALEKAGAIIADLAVDDLIGRLKEATRIGSIAGIEASHIHAStWLADLDANVDIRVKRPLSVRIKVPLEAYHA 320
256369013 274 AHFEASLAALEKAGAIIADLAVDDLIGRLKEATRIGSIAGIEASHIHAStWLADLDANVDIRVKRPLSVRIKVPLEAYHA 353
225852103 248 AHFEASLAALEKAGAIIADLAVDDLIGRLKEATRIGSIAGIEASHIHAStWLADLDANVDIRVKRPLSVRIKVPLEAYHA 327
163842852 248 AHFEASLAALEKAGAIIADLAVDDLIGRLKEATRIGSIAGIEASHIHAStWLADLDANVDIRVKRPLSVRIKVPLEAYHA 327
161618549 248 AHFEASLAALEKAGAIIADLAVDDLIGRLKEATRIGSIAGIEASHIHAStWLADLDANVDIRVKRPLSVRIKVPLEAYHA 327
227823710 252 KAFEAGLQRLSRAGARLAELEIDDLLARFAEATAIGSLAGLEASRIHAD-WLVDDEAPVDPRVKSPLRRRLAVPDTALEN 330
170743147 254 ADVEAALGRLAAAGARIADMTIDDLLERFALATAAAPIASVEAYEVHAD-WLDREGAGMDPRVRVRIERGRPVGAAAYLR 332
220923651 247 QAFEAALGRLGTESVRISDIALDDLLARMAEATAAAPVASVEAAEIHAD-WIDAEEAAFDPRVHARISRGRTVTAGTYIR 325
15966846  252 AAFERSLQAFSRAGAKLAACGIDDLLARFAEATAIGSLAGLEASRVHAD-WLLDDNAPVDIRVRSTLRRRLTVPDAAIED 330
150398181 252 AAFERSLQALSRAGAKLAECGIDDLLTRFAEATAIGSLAGLEASRVHAD-WLRDENAPVDIRLKFPLRRRLAIPDSAIHD 330
82699470  321 LMETRKALAREMDERLSGFDMFATPATPIVAPTIASVSHDEEEYDRVENLLLRDTQVANQFDLCSITLPMPGMKLPTGLM 400
256369013 354 LMETRKALAREMDERLSGFDMFATPATPIVAPTIASVSHDEEEYDRVENLLLRDTQVANQFDLCSITLPMPGMKLPTGLM 433
225852103 328 LMETRKALAREMDERLSGFDMFATPATPIVAPTIASVSHDEEEYDRVENLLLRDTQVANQFDLCSITLPMPGMKLPTGLM 407
163842852 328 LMETRKALAREMDERLSGFDMFATPATPIVAPTIASVSHDEEEYDRVENLLLRDTQVANQFDLCSITLPMPGMKLPTGLM 407
161618549 328 LMETRKALAREMDERLSGFDMFATPATPIVAPTIASVSHDEEEYDRVENLLLRDTQVANQFDLCSITLPMPGMKLPTGLM 407
227823710 331 LLKTRHALARAMDGRLAPFDLVLLPTTPIPAVRIAAVEEDKREYRRIEGLLLRNTEVANQFDLTAITLPMPGAALPAGLM 410
170743147 333 MMRARAELIRACDARLLPFDAVALPTTAIPAPTIASVAEDDEAFSRTNVLMLRNTMVGNLFDLTALSLPLPGRALPAGLM 412
220923651 326 MMRARAELIRACDDRLAGIDLLALPATAIPAVPIAAMAEDEA-FTRTNLLMLRNTMVGNLFDLTGVSLPLPGQALPVGLM 404
15966846  331 LLRTRQELMRAMDERLAPFDLTLLPTTPIPAVSIASVEEDRAEYRRVEDLLLRNTQVANQFDLTAISLPMAGTSRPAGLM 410
150398181 331 LLRTRQGLMRAMDERLRPFDFILMPATPIPAVSIASVEEDRAEYRRVEDLLLRNTQVANQFDLTAITLPMPGMSLPAGLM 410
82699470  401 LTARNDSDKRLLAAALSIEKLLEHD 425
256369013 434 LTARNDSDKRLLAAALSIEKLLEHD 458
225852103 408 LTARNDSDKRLLAAALSIEKLLEHD 432
163842852 408 LTARNDSDKRLLAAALSIEKLLEHD 432
161618549 408 LTARNDSDKRLLAAALSIEKLLEHD 432
227823710 411 LMGRNGTDRTLLRLAACVERLLQEG 435
170743147 413 LLARHGHDRRLLEIGAAIEACLG-- 435
220923651 405 LLARHGQDRRLLEIAAAVEARLC-- 427
15966846  411 LMGRHGADAMLLGAAAAMEDLLKNG 435
150398181 411 LMGRNGTDGALLRLAASVERLLQRG 435
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap