Conserved Protein Domain Family
PRK05937

?
PRK05937: PRK05937 
8-amino-7-oxononanoate synthase; Provisional
Statistics
?
PSSM-Id: 102071
View PSSM: PRK05937
Aligned: 14 rows
Threshold Bit Score: 632.587
Threshold Setting Gi: 15834778
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15605510    1 MKEALSIDFITNDFLGFSRSDSLVHAVEARYRLYCRDKPHAQLGYGGSRAILGSSSLLDGVEHQIAHFHGAPEALILPSG 80 
76789519    1 MKEALSIDFITNDFLGFSRSDSLVHAVEARYRLYCRDKPHAQLGYGGSRAILGSSSLLDGVEHQIAHFHGAPEALILPSG 80 
166154994   1 MKEALSIDFITNDFLGFSRLDSLVHAVEARYRLYCRDKPHAQLGYGGSRAILGSSSLLDGVEHQIAHFHGAPEALILPSG 80 
237803207   1 MKEALSIDFITNDFLGFSRSDSLVHAVEARYRLYCRDKPHAQLGYGGSRAILGSSSLLDGVEHQIAHFHGAPEALILPSG 80 
237805128   1 MKEALSIDFITNDFLGFSRSDSLVHAVEARYRLYCRDKPHAQLGYGGSRAILGSSSLLDGVEHQIAHFHGAPEALILPSG 80 
62185416    1 -MSECPIDFVTNDFLGFSRSTVLVNEVERRYRVYCEQFPHAQLGACGSRAIVGPSQTLQKLETKIAQFHQAEAAFVVHSG 79 
89897977    1 -MSECPIDFVTNDFLGFSRSTILVNEVEKRYRAYCEQFSHAQLGASGSRAILGPSQIQQDLEEKIAKFHNSESAFVVHSG 79 
29840603    1 -MSEYPIDFVTNDFLGFSRSTTLVKEVEKRYRAYCEEFSHAQLGARGSRAIAGPSQILQNLEKKIVDFHNAEAAFVVHNG 79 
16752113    1 MTTSDVIDFVTNDFLGFARSPTIYCEVSKRFQIHCQQFPHEKLGIRGSRLMVGPSSVIDDLESKIASYHGAPNAFIVNSG 80 
15618832    1 MTTSDVIDFVTNDFLGFARSPTIYCEVSKRFQIHCQQFPHEKLGIRGSRLMVGPSSVIDDLESKIASYHGAPNAFIVNSG 80 
15605510   81 FVANTAICAHLSSVADYVLWDEQVHISVSYNLSVfLSGWHQSFRHNDLDHLESLLESCQQRGFQRVFILVCSVYSFKGSF 160
76789519   81 FVANTAICAHLSSVADYVLWDEQVHISVSYNLSVfLSGWHQSFRHNDLDHLESLLESCQQRGFQRVFILVCSVYSFKGSF 160
166154994  81 FVANTAICAHLSSVADYVLWDEQVHISVSYNLSVfLSGWHQSFRHNDLDHLESLLESCQQRGFQRVFILVCSVYSFKGSF 160
237803207  81 FVANTAICAHLSSVADYVLWDEQVHISVSYNLSVfLSGWHQSFRHNDLDHLESLLESCQQRGFQRVFILVCSVYSFKGSF 160
237805128  81 FVANTAICAHLSSVADYVLWDEQVHISVSYNLSVfLSGWHQSFRHNDLDHLESLLESCQQRGFQRVFILVCSVYSFKGSF 160
62185416   80 YMANLGFCYHISKDTDMVFWDASVHISVVQSLKM-ISGKHQSFPHNDLTALESLLMSHRAVSSGRIFIFVCSVYSFLGTL 158
89897977   80 YMANLGLCYHISKNTDIVFWDESVHISVAQSLRV-ISGEHQAFPHNDLCALESLLISHRAVSSGRIFIFVCSVYSFSGTL 158
29840603   80 YMANLGFCYHISKDTDKVFWDESVHVSVVQSLKM-ISGKQQSFPHNDLDALESLLIAHRAVSSGRIFIFVCSVYSFSGTS 158
16752113   81 YMANLGLCHHVSRSTDVLLWDEEVHMSVVHSLSA-ISGQHHTFHHNNLEHLESLLQCYRISSKGRIFIFVSSVYSFRGTL 159
15618832   81 YMANLGLCHHVSRSTDVLLWDEEVHMSVVHSLSA-ISGQHHTFHHNNLEHLESLLQCYRISSKGRIFIFVSSVYSFRGTL 159
15605510  161 ALLEQIVALSHQYHAQLIVDEAHAVGLFGDAGKGFCASLGYENFYSVLVTFSKALGSAGAAWLSSRDRKQDLI-KEPMVS 239
76789519  161 ALLEQIVALSHQYHAQLIVDEAHAVGLFGDAGKGFCASLGYENFYSVLVTFSKALGSAGAAWLSSRDRKQDLI-KEPMVS 239
166154994 161 APLEQIVALSHQYHAQLIVDEAHAVGLFGDAGKGFCASLGYENFYSVLVTFSKALGSAGAAWLSSCDRKQDLI-KEPMVS 239
237803207 161 ALLEQIVALSHQYHAQLIVDEAHAVGLFGDAGKGFCASLGYENFYSVLVTFSKALGSAGAAWLSSRDRKQDLI-KEPMVS 239
237805128 161 ALLEQIVALSHQYHAQLIVDEAHAVGLFGDAGKGFCASLGYENFYSVLVTFSKALGSAGAAWLSSRDRKQDLI-KEPMVS 239
62185416  159 APLEELLPLSRKYHAHLIVDEAHAMGIFGEEGRGFCHTWGYENFYAVLVTYSKAMGAMGAAILSSSEVKTELLlNSPPLR 238
89897977  159 APLEELIALSKKYNAHLIVDEAHAMGILGEEGRGLCHKWGYENFYAVLVTYSKAMGAMGAALLSSLEVKTELMlSSPPLR 238
29840603  159 APLEELIDLSRKYHAHIIVDEAHAMGIFGEDGRGLCHQWGYENFYSVLVTYSKAMGAMGAAILCSSEVKTELMlNSPPLR 238
16752113  160 APLEQIIALSKKYHAHLIVDEAHAMGIFGDDGKGLCHALGYENFYAVLVTYGKALGTMGASLLTSSEVKYDLMqNSPPLR 239
15618832  160 APLEQIIALSKKYHAHLIVDEAHAMGIFGDDGKGLCHALGYENFYAVLVTYGKALGTMGASLLTSSEVKYDLMqNSPPLR 239
15605510  240 LSTGIPPYLLVSIQVAYEFLSQEGELARTRLRRIRDYFAQKISWAAAGFVQPLSLPGISEQELYQKLVATGIRVGVACPP 319
76789519  240 LSTGIPPYLLVSIQVAYEFLSQEGELARTRLRRIRDYFAQKISWAAAGFVQPLSLPGISEQELYQKLVATGIRVGVACPP 319
166154994 240 LSTGIPPYLLVSIQVAYEFLSQEGELARTRLRRIRDYFAQKISWAAAGFVQPLSLPGISEQELYQKLVATGIRVGVACPP 319
237803207 240 LSTGIPPYLLVSIQVAYEFLSQEGELARTRLRRIRDYFAQKISWAAAGFVQPLSLPGISEQELYQKLVATGIRVGVACPP 319
237805128 240 LSTGIPPYLLVSIQVAYEFLSQEGELARTRLRRIRDYFAQKISWAAAGFVQPLSLPGISEQELYQKLVATGIRVGVACPP 319
62185416  239 YTTALAPHALIAISAAYDHLLVAGELARKQVFALQAYFQQYFGLSSQGCGQPVFLQDLHRDLLVSLLNEANLRVSWVNFT 318
89897977  239 YTTALAPHALITIGASYDHLVLEGERARQKIFNLKAYFQKPFGLSSQCCGQPVFLRDFNMDLLTSMLDEANLRVGLMTFA 318
29840603  239 YTTALAPHALITIDSAYDHLLLEGEHSRKQMFSLKAYFQEHFGLHSQCCGQPIWLKDFNIDLFTSMLDEANLRVGLMTFV 318
16752113  240 YSTSLSPHTLISIGTAYDFLASEGEIARKQVFKLKEHFHECFDSHAPGCVQPIFLPHTCLEEAISVLETTGIHVGVVAFA 319
15618832  240 YSTSLSPHTLISIGTAYDFLASEGEIARKQVFKLKEHFHECFDSHAPGCVQPIFLPHTCLEEAISVLETTGIHVGVVAFA 319
15605510  320 TGKVLRANLHAFNTEQEVDILVSLLATEQVTYQKNVVTGSTSTMQRTLEDN 370
76789519  320 TGKVLRANLHAFNTEQEVDILVSLLATEQVTYQKNVVTGSTSTMQRTLEDN 370
166154994 320 TGKVLRANLHAFNTEQEVDILVSLLATEQVTYQKNVVTGSTSTMQRTLEDN 370
237803207 320 TGKVLRANLHAFNTEQEVDILVSLLATEQVTYQKNVVTGSTSTMQRTLEDN 370
237805128 320 TGKVLRANLHAFNTEQEVDILVSLLATEQVTYQKNVVTGSTSTMQRTLEDN 370
62185416  319 DKPFIRVNFHAFNHQDEVDLLIAVLHSYLEKCGCRIDVNHEFDFGRQFCR- 368
89897977  319 HRPFIRVNFHAYNNHDEVDILVAMLHSYLEKCCCGIDVDHELYFRREFCR- 368
29840603  319 NKPFIRVNFHTYNTRDEVDVLVAMLHSYLEKCCCGIDIDHELYFRR----- 364
16752113  320 KHPFLRVNLHAYNTVDEVNLLAQVMKPYLEKSSHRVHINHEFHLWRELCQH 370
15618832  320 KHPFLRVNLHAYNTVDEVNLLAQVMKPYLEKSSHRVHINHEFHLWRELCQH 370
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap