Conserved Protein Domain Family
PRK05934

?
PRK05934: PRK05934 
type III secretion system protein; Validated
Statistics
?
PSSM-Id: 168300
View PSSM: PRK05934
Aligned: 14 rows
Threshold Bit Score: 477.42
Threshold Setting Gi: 15834717
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16752179    1 MFFQNLAKKLTAlgISPLGCLLIGGVVSCAILFgRSSNPSLAPTQVKTEKTSGNWLKLTQMGNPKLIESLTKKEQLEKDL 80 
15605452    3 VLPRFLKNKIAY--TKSLGYLLAAILIGFIMLY-KPSSPQPTPTVASTEKKPSHWLKLSHLGNLQSIEIQAKKEQLEKDL 79 
76789459    3 VLPRFLKNKIAS--TKSLGYLLAAILIGFIMLY-KPSSPQPTPTVASTEKKPSHWLKLSHLGNLQSIEIQAKKEQLEKDL 79 
166154936   3 VLPRFLKNKIAS--TKSLGYLLAAILIGFIMLY-KPSSPQPTPTVASTEKKPSHWLKLSHLGNLQSIEIQAKKEQLEKDL 79 
237803149   3 VLPRFLKNKIAS--TKSLGYLLAAILIGFIMLY-KPSSPQPTPTVASTEKKPSHWLKLSHLGNLQSIEIQAKKEQLEKDL 79 
237805070   3 VLPRFLKNKIAS--TKSLGYLLAAILIGFIMLY-KPSSPQPTPTVASTEKKPSHWLKLSHLGNLQSIEIQAKKEQLEKDL 79 
62185477    1 MFFQFLKKKVASlgISPLGILLVFSALGGAIFFrNNASNSPDFPSPPEKKTSG-WLKLSQVAHPKLLESLAKKEQLERDL 79 
89897914    1 MFFQFLKKKVASlgISPLGLLVISSALGSAIFFgKNTSKSPDFSPPSEKKTTG-WFKLSQVGNPKLLESLAKKEQIERDL 79 
15618769    1 MFFQNLAKKLTAlgISPLGCLLIGGVVSCAILFgRSSNPSLAPTQVKTEKTSGNWLKLTQMGNPKLIESLTKKEQLEKDL 80 
15836393    1 MFFQNLAKKLTAlgISPLGCLLIGGVVSCAILFgRSSNPSLAPTQVKTEKTSGNWLKLTQMGNPKLIESLTKKEQLEKDL 80 
16752179   81 TSFHPIASAKVAIALSTEddvmSPLHLSVILTLRKEESLTPSLLFSITDYLCSSLPGLKREHISLSDNLGNLYIPESITV 160
15605452   80 TLFEPVLQATVALSQEED----SLAEISVILSLPQASTLSPSLVHSITDYLTRSVPGLTKEHITLSDQHGNLYSPLFEQS 155
76789459   80 TLFEPVLQATVALSQEED----SLAEISVILSLPQASTLSPSLVHSITDYLTRSVPGLTKEYITLSDQHGNLYSPLFEQS 155
166154936  80 TLFEPVLQATVALSQEED----SLAEISVILSLPQASTLSPSLVHSITDYLTRSVPGLTKEHITLSDQHGNLYSPLFEQS 155
237803149  80 TLFEPVLQATVALSQEED----SLAEISVILSLPQASTLSPSLVHSITDYLTRSVPGLTKEHITLSDQHGNLYSPLFEQS 155
237805070  80 TLFEPVLQATVALSQEED----SLAEISVILSLPQASTLSPSLVHSITDYLTRSVPGLTKEHITLSDQHGNLYSPLFEQS 155
62185477   80 TMFQPVAHATVALSLPTEddphIVPQVSVILSSHKNEMFSLPLLQSITDYLSSSVPGLTKEHITLSDNLGNTYSPGELST 159
89897914   80 TMFQSVASATVALSLPTEddphIIPQVSVILSTRKNETFSSSLLHSITDYLSSSIPGLTKEHITLSDNLGNVYSPGEISK 159
15618769   81 TSFHPIASAKVAIALSTEddvmSPLHLSVILTLRKEESLTPSLLFSITDYLCSSLPGLKREHISLSDNLGNLYIPESITV 160
15836393   81 TSFHPIASAKVAIALSTEddvmSPLHLSVILTLRKEESLTPSLLFSITDYLCSSLPGLKREHISLSDNLGNLYIPESITV 160
16752179  161 NSLFIHTLENYLGKIFPKEHFALAYHAKAEKPTLQLTLNENYIAHLTKEESEKIVAHTKHYLyQNYDDSYDiVIETLPFA 240
15605452  156 NTLLTTSLERSLQTILPQTHFALNYIPVADEGHLQLLVDEDYLNTLPKGARVKLLSHMQEIL-SAFPEMHP-SVDIVPFL 233
76789459  156 NTLLTTSLERSLQTILPQTHFALNYIPVADEGHLQLLVDEDYLNTLPKGARVKLLSHMQEIL-SAFPEMHP-SVDIVPFL 233
166154936 156 NTLLTTSLERSLQTILPQTHFALNYIPVADEGHLQLLVDEDYLNTLPKGARVKLLSHMQEIL-SAFSEMHP-SVDIVPFL 233
237803149 156 NTLLTTSLERSLQTILPQTHFALNYIPVADEGHLQLLVDEDYLNTLPKGARVKLLSHMQEIL-SAFPEMHP-SVDIVPFL 233
237805070 156 NTLLTTSLERSLQTILPQTHFALNYIPVADEGHLQLLVDEDYLNTLPKGARVKLLSHMQEIL-SAFPEMHP-SVDIVPFL 233
62185477  160 NSLLLSACEQYLGKIFPKEHFALACL-ANNTPGIQLTINEKYLAKFPKEKRTTFLLHAEEHLkKICGPAQPiVIEKFPFS 238
89897914  160 NSLFLSTCEGYLGKIFPKEHFILSYL-ANNTPTIQLTINEKYLAKFSKAKREAFLVHAEEHLkKIYGHTHSiVIERFPFS 238
15618769  161 NSLFIHTLENYLGKIFPKEHFALAYHAKAEKPTLQLTLNENYIAHLTKEESEKIVAHTKHYLyQNYDDSYDiVIETLPFA 240
15836393  161 NSLFIHTLENYLGKIFPKEHFALAYHAKAEKPTLQLTLNENYIAHLTKEESEKIVAHTKHYLyQNYDDSYDiVIETLPFA 240
16752179  241 R-LQNKKSFPAKVLIGSMILVISLMIVALASFYLARHAYERVSPEPRKIkRGINISKLLEIIQKESPEKIALILSYLDPK 319
15605452  234 KpVAHKTSRLSSIVLSITIVLLSLGILGFATFYLAFHTYDHVSQQKEKI-QSINIPKLIEMMKRESPEKVALILSYLDSA 312
76789459  234 KpVAHKTSRLSSIVLSITIVLLSLGILGFATFYLAFHTYDHVSQQKEKI-QSINIPKLIEMMKRESPEKVALILSYLDSA 312
166154936 234 KpVAHKTSRLSSIVLSITIVLLSLGILGFATFYLAFHTYDHVSQQKEKI-QSINIPKLIEMMKRESPEKVALILSYLDSA 312
237803149 234 KpVAHKTSRLSSIVLSITIVLLSLGILGFATFYLAFHTYDHVSQQKEKI-QSINIPKLIEMMKRESPEKVALILSYLDSA 312
237805070 234 KpVAHKTSRLSSIVLSITIVLLSLGILGFATFYLAFHTYDHVSQQKEKI-QSINIPKLIEMMKRESPEKVALILSYLDSA 312
62185477  239 Q-TIKKDRLSYKLLVGGTILLSSLGIIALASFYLAFYAYECIPSESKKIkQGINITKLVEILQKESPEKIRLILSYLDPK 317
89897914  239 Q-TSKKDWLSYRLLVGGTILLSSLGIIAVASFYLAFYAYERIPSESKKIkQGINITKLVEILQKESPEKIRLILSYLDPK 317
15618769  241 R-LQNKKSFPAKVLIGSMILVISLMIVALASFYLARHAYERVSPEPRKIkRGINISKLLEIIQKESPEKIALILSYLDPK 319
15836393  241 R-LQNKKSFPAKVLIGSMILVISLMIVALASFYLARHAYERVSPEPRKIkRGINISKLLEIIQKESPEKIALILSYLDPK 319
16752179  320 KAEALLNRLPEDLKHQVLKYKL 341
15605452  313 KAEELLNKLPEEMKSAVLKLRT 334
76789459  313 KAEELLNKLPEEMKSAVLKLRT 334
166154936 313 KAEELLNKLPEEMKSAVLKLRT 334
237803149 313 KAEELLNKLPEEMKSAVLKLRT 334
237805070 313 KAEELLNKLPEEMKSAVLKLRT 334
62185477  318 KADEIFKHLPEDIKHQVLKL-- 337
89897914  318 KAEEIFKHLPEDIQHQVLKL-- 337
15618769  320 KAEALLNRLPEDLKHQVLKYKL 341
15836393  320 KAEALLNRLPEDLKHQVLKYKL 341
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap